Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3661765..3662383 | Replicon | chromosome |
Accession | NZ_CP101210 | ||
Organism | Escherichia coli strain EC21Z-147 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NML26_RS18035 | Protein ID | WP_001291435.1 |
Coordinates | 3662165..3662383 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A8S7S0Y3 |
Locus tag | NML26_RS18030 | Protein ID | WP_039004128.1 |
Coordinates | 3661765..3662139 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML26_RS18020 (3656854) | 3656854..3658047 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NML26_RS18025 (3658070) | 3658070..3661219 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NML26_RS18030 (3661765) | 3661765..3662139 | + | 375 | WP_039004128.1 | Hha toxicity modulator TomB | Antitoxin |
NML26_RS18035 (3662165) | 3662165..3662383 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NML26_RS18040 (3662555) | 3662555..3663106 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NML26_RS18045 (3663222) | 3663222..3663692 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NML26_RS18050 (3663856) | 3663856..3665406 | + | 1551 | WP_001317659.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NML26_RS18055 (3665448) | 3665448..3665801 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NML26_RS18065 (3666180) | 3666180..3666491 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NML26_RS18070 (3666522) | 3666522..3667094 | - | 573 | WP_000779821.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251523 WP_001291435.1 NZ_CP101210:3662165-3662383 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14587.42 Da Isoelectric Point: 4.7395
>AT251523 WP_039004128.1 NZ_CP101210:3661765-3662139 [Escherichia coli]
MDEYSPKRHDITQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDITQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|