Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3243577..3244282 | Replicon | chromosome |
| Accession | NZ_CP101210 | ||
| Organism | Escherichia coli strain EC21Z-147 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | NML26_RS15860 | Protein ID | WP_000539521.1 |
| Coordinates | 3243577..3243963 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NML26_RS15865 | Protein ID | WP_001280945.1 |
| Coordinates | 3243953..3244282 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML26_RS15840 (3239581) | 3239581..3240207 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| NML26_RS15845 (3240204) | 3240204..3241319 | - | 1116 | WP_000555041.1 | aldose sugar dehydrogenase YliI | - |
| NML26_RS15850 (3241430) | 3241430..3241813 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| NML26_RS15855 (3242026) | 3242026..3243351 | + | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| NML26_RS15860 (3243577) | 3243577..3243963 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NML26_RS15865 (3243953) | 3243953..3244282 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| NML26_RS15870 (3244352) | 3244352..3245680 | - | 1329 | WP_000086919.1 | GGDEF domain-containing protein | - |
| NML26_RS15875 (3245688) | 3245688..3248036 | - | 2349 | Protein_3115 | EAL domain-containing protein | - |
| NML26_RS15880 (3248214) | 3248214..3249125 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T251521 WP_000539521.1 NZ_CP101210:3243577-3243963 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|