Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2684175..2684811 | Replicon | chromosome |
Accession | NZ_CP101210 | ||
Organism | Escherichia coli strain EC21Z-147 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A5F1EUB3 |
Locus tag | NML26_RS13105 | Protein ID | WP_000813796.1 |
Coordinates | 2684635..2684811 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NML26_RS13100 | Protein ID | WP_076838470.1 |
Coordinates | 2684175..2684591 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML26_RS13080 (2679327) | 2679327..2680268 | - | 942 | WP_001251307.1 | ABC transporter permease | - |
NML26_RS13085 (2680269) | 2680269..2681282 | - | 1014 | WP_000220433.1 | ABC transporter ATP-binding protein | - |
NML26_RS13090 (2681300) | 2681300..2682445 | - | 1146 | WP_000047448.1 | ABC transporter substrate-binding protein | - |
NML26_RS13095 (2682690) | 2682690..2684096 | - | 1407 | WP_254824968.1 | PLP-dependent aminotransferase family protein | - |
NML26_RS13100 (2684175) | 2684175..2684591 | - | 417 | WP_076838470.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NML26_RS13105 (2684635) | 2684635..2684811 | - | 177 | WP_000813796.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NML26_RS13110 (2685033) | 2685033..2685263 | + | 231 | WP_000494243.1 | YncJ family protein | - |
NML26_RS13115 (2685355) | 2685355..2687316 | - | 1962 | WP_001317809.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NML26_RS13120 (2687389) | 2687389..2687925 | - | 537 | WP_000429147.1 | DNA-binding transcriptional regulator SutR | - |
NML26_RS13125 (2688017) | 2688017..2689189 | + | 1173 | WP_001236216.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T251519 WP_000813796.1 NZ_CP101210:c2684811-2684635 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15219.59 Da Isoelectric Point: 4.5908
>AT251519 WP_076838470.1 NZ_CP101210:c2684591-2684175 [Escherichia coli]
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|