Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1492267..1492892 | Replicon | chromosome |
Accession | NZ_CP101210 | ||
Organism | Escherichia coli strain EC21Z-147 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | NML26_RS07255 | Protein ID | WP_000911329.1 |
Coordinates | 1492494..1492892 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NML26_RS07250 | Protein ID | WP_000450524.1 |
Coordinates | 1492267..1492494 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML26_RS07225 (1488067) | 1488067..1488537 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NML26_RS07230 (1488537) | 1488537..1489109 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NML26_RS07235 (1489255) | 1489255..1490133 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NML26_RS07240 (1490150) | 1490150..1491184 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NML26_RS07245 (1491397) | 1491397..1492110 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NML26_RS07250 (1492267) | 1492267..1492494 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NML26_RS07255 (1492494) | 1492494..1492892 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NML26_RS07260 (1493039) | 1493039..1493902 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NML26_RS07265 (1493917) | 1493917..1495932 | + | 2016 | WP_000829310.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NML26_RS07270 (1496006) | 1496006..1496704 | + | 699 | WP_000679819.1 | esterase | - |
NML26_RS07275 (1496785) | 1496785..1496985 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T251512 WP_000911329.1 NZ_CP101210:1492494-1492892 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |