Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 380967..381562 Replicon chromosome
Accession NZ_CP101210
Organism Escherichia coli strain EC21Z-147

Toxin (Protein)


Gene name doc Uniprot ID D6JG31
Locus tag NML26_RS01810 Protein ID WP_000155159.1
Coordinates 381185..381562 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag NML26_RS01805 Protein ID WP_000557315.1
Coordinates 380967..381188 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML26_RS01780 (376043) 376043..377152 + 1110 WP_001318085.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NML26_RS01785 (377200) 377200..378126 + 927 WP_000003010.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NML26_RS01790 (378123) 378123..379400 + 1278 WP_000803825.1 branched chain amino acid ABC transporter permease LivM -
NML26_RS01795 (379397) 379397..380164 + 768 WP_000082101.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NML26_RS01800 (380166) 380166..380879 + 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NML26_RS01805 (380967) 380967..381188 + 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NML26_RS01810 (381185) 381185..381562 + 378 WP_000155159.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NML26_RS01815 (381771) 381771..383087 + 1317 WP_000803191.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NML26_RS01820 (383263) 383263..384150 + 888 WP_000099289.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NML26_RS01825 (384147) 384147..384992 + 846 WP_000572164.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NML26_RS01830 (384994) 384994..386064 + 1071 WP_000907828.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 378123..386804 8681


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(27-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13964.25 Da        Isoelectric Point: 6.7263

>T251508 WP_000155159.1 NZ_CP101210:381185-381562 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT251508 WP_000557315.1 NZ_CP101210:380967-381188 [Escherichia coli]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D6JG31

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References