Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 72634..73159 | Replicon | plasmid pEC21Z151-89K |
| Accession | NZ_CP101199 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | NML27_RS25475 | Protein ID | WP_001159868.1 |
| Coordinates | 72634..72939 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NML27_RS25480 | Protein ID | WP_000813634.1 |
| Coordinates | 72941..73159 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML27_RS25460 (68544) | 68544..69710 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| NML27_RS25465 (70298) | 70298..71053 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| NML27_RS25470 (71827) | 71827..72633 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| NML27_RS25475 (72634) | 72634..72939 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NML27_RS25480 (72941) | 72941..73159 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NML27_RS25485 (73867) | 73867..74862 | + | 996 | WP_000246635.1 | hypothetical protein | - |
| NML27_RS25490 (74866) | 74866..75798 | + | 933 | WP_000991831.1 | S-4TM family putative pore-forming effector | - |
| NML27_RS25495 (76096) | 76096..77184 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
| NML27_RS25500 (77177) | 77177..78055 | + | 879 | WP_225522546.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(3)-IId / blaTEM-1B | - | 1..88826 | 88826 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T251501 WP_001159868.1 NZ_CP101199:c72939-72634 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|