Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4575643..4576475 | Replicon | chromosome |
| Accession | NZ_CP101197 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | NML27_RS21990 | Protein ID | WP_000854753.1 |
| Coordinates | 4576101..4576475 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | NML27_RS21985 | Protein ID | WP_001540478.1 |
| Coordinates | 4575643..4576011 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML27_RS21950 (4571475) | 4571475..4572155 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| NML27_RS21955 (4572303) | 4572303..4572980 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| NML27_RS21960 (4572986) | 4572986..4573219 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| NML27_RS21965 (4573309) | 4573309..4574127 | + | 819 | WP_023909075.1 | DUF932 domain-containing protein | - |
| NML27_RS21970 (4574219) | 4574219..4574704 | + | 486 | WP_001586019.1 | antirestriction protein | - |
| NML27_RS21975 (4574720) | 4574720..4575196 | + | 477 | WP_001186773.1 | RadC family protein | - |
| NML27_RS21980 (4575259) | 4575259..4575480 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| NML27_RS21985 (4575643) | 4575643..4576011 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NML27_RS21990 (4576101) | 4576101..4576475 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| NML27_RS21995 (4576472) | 4576472..4576960 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| NML27_RS22000 (4576972) | 4576972..4577169 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| NML27_RS22005 (4577266) | 4577266..4577835 | + | 570 | WP_016231187.1 | DUF4942 domain-containing protein | - |
| NML27_RS22010 (4578584) | 4578584..4580122 | + | 1539 | WP_001187178.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4563526..4587935 | 24409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T251490 WP_000854753.1 NZ_CP101197:4576101-4576475 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT251490 WP_001540478.1 NZ_CP101197:4575643-4576011 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |