Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3331422..3332127 | Replicon | chromosome |
Accession | NZ_CP101197 | ||
Organism | Escherichia coli strain EC21Z-151 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NML27_RS16200 | Protein ID | WP_000539521.1 |
Coordinates | 3331422..3331808 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NML27_RS16205 | Protein ID | WP_001280945.1 |
Coordinates | 3331798..3332127 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML27_RS16180 (3327426) | 3327426..3328052 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
NML27_RS16185 (3328049) | 3328049..3329164 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
NML27_RS16190 (3329275) | 3329275..3329658 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NML27_RS16195 (3329871) | 3329871..3331196 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NML27_RS16200 (3331422) | 3331422..3331808 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NML27_RS16205 (3331798) | 3331798..3332127 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NML27_RS16210 (3332197) | 3332197..3333525 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
NML27_RS16215 (3333533) | 3333533..3335881 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
NML27_RS16220 (3336059) | 3336059..3336970 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T251484 WP_000539521.1 NZ_CP101197:3331422-3331808 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|