Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2641381..2642019 | Replicon | chromosome |
| Accession | NZ_CP101197 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | NML27_RS12635 | Protein ID | WP_000813795.1 |
| Coordinates | 2641843..2642019 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NML27_RS12630 | Protein ID | WP_076797675.1 |
| Coordinates | 2641381..2641797 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML27_RS12610 (2636533) | 2636533..2637474 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| NML27_RS12615 (2637475) | 2637475..2638488 | - | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| NML27_RS12620 (2638506) | 2638506..2639651 | - | 1146 | Protein_2472 | ABC transporter substrate-binding protein | - |
| NML27_RS12625 (2639896) | 2639896..2641302 | - | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| NML27_RS12630 (2641381) | 2641381..2641797 | - | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NML27_RS12635 (2641843) | 2641843..2642019 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NML27_RS12640 (2642241) | 2642241..2642471 | + | 231 | WP_023910283.1 | YncJ family protein | - |
| NML27_RS12645 (2642563) | 2642563..2644524 | - | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NML27_RS12650 (2644597) | 2644597..2645133 | - | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| NML27_RS12655 (2645225) | 2645225..2646397 | + | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T251482 WP_000813795.1 NZ_CP101197:c2642019-2641843 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT251482 WP_076797675.1 NZ_CP101197:c2641797-2641381 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|