Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 977245..977899 | Replicon | chromosome |
Accession | NZ_CP101197 | ||
Organism | Escherichia coli strain EC21Z-151 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NML27_RS04780 | Protein ID | WP_000244781.1 |
Coordinates | 977492..977899 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NML27_RS04775 | Protein ID | WP_000354046.1 |
Coordinates | 977245..977511 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML27_RS04755 (973333) | 973333..974766 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
NML27_RS04760 (974811) | 974811..975122 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
NML27_RS04765 (975286) | 975286..975945 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NML27_RS04770 (976022) | 976022..977002 | - | 981 | WP_000886079.1 | tRNA-modifying protein YgfZ | - |
NML27_RS04775 (977245) | 977245..977511 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NML27_RS04780 (977492) | 977492..977899 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
NML27_RS04785 (977939) | 977939..978460 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NML27_RS04790 (978572) | 978572..979468 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NML27_RS04795 (979493) | 979493..980203 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NML27_RS04800 (980209) | 980209..981942 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T251474 WP_000244781.1 NZ_CP101197:977492-977899 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|