Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 160468..161080 | Replicon | chromosome |
| Accession | NZ_CP101197 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | NML27_RS00690 | Protein ID | WP_000833473.1 |
| Coordinates | 160468..160653 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | L4IWR9 |
| Locus tag | NML27_RS00695 | Protein ID | WP_000499744.1 |
| Coordinates | 160670..161080 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML27_RS00680 (157309) | 157309..158460 | + | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
| NML27_RS00685 (158661) | 158661..160199 | + | 1539 | WP_001551836.1 | aldehyde dehydrogenase AldB | - |
| NML27_RS00690 (160468) | 160468..160653 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NML27_RS00695 (160670) | 160670..161080 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NML27_RS00700 (161152) | 161152..163116 | - | 1965 | WP_001551835.1 | glycoside hydrolase family 127 protein | - |
| NML27_RS00705 (163127) | 163127..164527 | - | 1401 | WP_000204811.1 | MFS transporter | - |
| NML27_RS00710 (164753) | 164753..165568 | + | 816 | WP_000891823.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T251470 WP_000833473.1 NZ_CP101197:160468-160653 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT251470 WP_000499744.1 NZ_CP101197:160670-161080 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|