Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 4074846..4075408 | Replicon | chromosome |
Accession | NZ_CP101185 | ||
Organism | Paenarthrobacter ureafaciens strain SD-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NL394_RS19200 | Protein ID | WP_021472908.1 |
Coordinates | 4075118..4075408 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7M2BYL4 |
Locus tag | NL394_RS19195 | Protein ID | WP_021472907.1 |
Coordinates | 4074846..4075121 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL394_RS19175 (NL394_19130) | 4071069..4072106 | - | 1038 | WP_031216691.1 | zinc-dependent alcohol dehydrogenase family protein | - |
NL394_RS19180 (NL394_19135) | 4072236..4073048 | - | 813 | WP_021472904.1 | hypothetical protein | - |
NL394_RS19185 (NL394_19140) | 4073095..4073736 | - | 642 | WP_021472905.1 | LysE family translocator | - |
NL394_RS19190 (NL394_19145) | 4073935..4074813 | + | 879 | WP_043427191.1 | prephenate dehydratase | - |
NL394_RS19195 (NL394_19150) | 4074846..4075121 | + | 276 | WP_021472907.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL394_RS19200 (NL394_19155) | 4075118..4075408 | + | 291 | WP_021472908.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL394_RS19205 (NL394_19160) | 4075420..4076397 | - | 978 | WP_021472909.1 | thioredoxin-disulfide reductase | - |
NL394_RS19210 (NL394_19165) | 4076461..4078632 | - | 2172 | WP_069696782.1 | MMPL family transporter | - |
NL394_RS19215 (NL394_19170) | 4078795..4079430 | + | 636 | WP_259362707.1 | MarR family transcriptional regulator | - |
NL394_RS19220 (NL394_19175) | 4079511..4080326 | + | 816 | WP_021474094.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10888.46 Da Isoelectric Point: 10.0347
>T251469 WP_021472908.1 NZ_CP101185:4075118-4075408 [Paenarthrobacter ureafaciens]
VSNSSLEGEPWNIQVTSPALKTFHRLPEKAASAIVEFITGALAGNPHRLSKPLTNELLGMRTARRGDYRVLFTLDIEDHV
LYVHRIQHRADVYKPR
VSNSSLEGEPWNIQVTSPALKTFHRLPEKAASAIVEFITGALAGNPHRLSKPLTNELLGMRTARRGDYRVLFTLDIEDHV
LYVHRIQHRADVYKPR
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|