Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 4598067..4598430 Replicon chromosome
Accession NZ_CP101178
Organism Xanthomonas campestris pv. campestris strain CN13

Toxin (Protein)


Gene name EcnB Uniprot ID G0CKD4
Locus tag XCCCN13v2_RS20160 Protein ID WP_011270059.1
Coordinates 4598067..4598201 (-) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID Q8P3Z2
Locus tag XCCCN13v2_RS20165 Protein ID WP_011038999.1
Coordinates 4598278..4598430 (-) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XCCCN13v2_RS20140 4593331..4594983 - 1653 WP_043877841.1 M28 family metallopeptidase -
XCCCN13v2_RS20145 4595148..4596092 - 945 WP_043877842.1 MBL fold metallo-hydrolase -
XCCCN13v2_RS20150 4596176..4597465 - 1290 WP_029629069.1 tryptophan--tRNA ligase -
XCCCN13v2_RS20155 4597625..4597834 - 210 WP_011038998.1 CsbD family protein -
XCCCN13v2_RS20160 4598067..4598201 - 135 WP_011270059.1 entericidin A/B family lipoprotein Toxin
XCCCN13v2_RS20165 4598278..4598430 - 153 WP_011038999.1 entericidin A/B family lipoprotein Antitoxin
XCCCN13v2_RS20170 4598541..4599464 - 924 WP_011039000.1 arginase -
XCCCN13v2_RS20175 4599778..4600239 + 462 WP_011039001.1 roadblock/LC7 domain-containing protein -
XCCCN13v2_RS20180 4600322..4600681 + 360 WP_011039002.1 hypothetical protein -
XCCCN13v2_RS20185 4600784..4601701 + 918 WP_011039003.1 hypothetical protein -
XCCCN13v2_RS20190 4601698..4602240 + 543 WP_011039004.1 GTPase -
XCCCN13v2_RS20195 4602575..4603258 + 684 WP_050911792.1 dTMP kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-42)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4431.27 Da        Isoelectric Point: 9.3487

>T251467 WP_011270059.1 NZ_CP101178:c4598201-4598067 [Xanthomonas campestris pv. campestris]
MKRAIALLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5173.15 Da        Isoelectric Point: 8.2782

>AT251467 WP_011038999.1 NZ_CP101178:c4598430-4598278 [Xanthomonas campestris pv. campestris]
MKRLLTLMVLGLFSAGMMTGCNTMAGAGKDMQGAGDKVEKTADKCSDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2XDQ0

Antitoxin

Source ID Structure
AlphaFold DB Q8P3Z2

References