Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1273050..1273828 | Replicon | chromosome |
| Accession | NZ_CP101178 | ||
| Organism | Xanthomonas campestris pv. campestris strain CN13 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | Q8P667 |
| Locus tag | XCCCN13v2_RS05385 | Protein ID | WP_011038220.1 |
| Coordinates | 1273050..1273541 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | Q8P668 |
| Locus tag | XCCCN13v2_RS05390 | Protein ID | WP_011038219.1 |
| Coordinates | 1273538..1273828 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XCCCN13v2_RS05370 | 1269378..1270253 | + | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| XCCCN13v2_RS05375 | 1270903..1271580 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
| XCCCN13v2_RS05380 | 1271573..1272907 | + | 1335 | WP_019237347.1 | HAMP domain-containing sensor histidine kinase | - |
| XCCCN13v2_RS05385 | 1273050..1273541 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
| XCCCN13v2_RS05390 | 1273538..1273828 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
| XCCCN13v2_RS05395 | 1273903..1274304 | - | 402 | WP_019237348.1 | SymE family type I addiction module toxin | - |
| XCCCN13v2_RS05400 | 1274836..1275459 | - | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
| XCCCN13v2_RS05405 | 1275473..1276336 | - | 864 | WP_011038216.1 | A24 family peptidase | - |
| XCCCN13v2_RS05410 | 1276343..1277599 | - | 1257 | WP_011038215.1 | type II secretion system F family protein | - |
| XCCCN13v2_RS05415 | 1277926..1278366 | + | 441 | WP_011038214.1 | pilin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T251466 WP_011038220.1 NZ_CP101178:c1273541-1273050 [Xanthomonas campestris pv. campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|