Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1233074..1233852 | Replicon | chromosome |
| Accession | NZ_CP101176 | ||
| Organism | Xanthomonas campestris pv. campestris strain CN08 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | Q8P667 |
| Locus tag | XCCCN08v2_RS05185 | Protein ID | WP_011038220.1 |
| Coordinates | 1233074..1233565 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | Q8P668 |
| Locus tag | XCCCN08v2_RS05190 | Protein ID | WP_011038219.1 |
| Coordinates | 1233562..1233852 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XCCCN08v2_RS05170 | 1229402..1230277 | + | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| XCCCN08v2_RS05175 | 1230927..1231604 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
| XCCCN08v2_RS05180 | 1231597..1232931 | + | 1335 | WP_162808569.1 | HAMP domain-containing sensor histidine kinase | - |
| XCCCN08v2_RS05185 | 1233074..1233565 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
| XCCCN08v2_RS05190 | 1233562..1233852 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
| XCCCN08v2_RS05195 | 1233927..1234328 | - | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| XCCCN08v2_RS05200 | 1234471..1235579 | + | 1109 | WP_087942068.1 | IS3 family transposase | - |
| XCCCN08v2_RS05205 | 1236064..1236687 | - | 624 | WP_075285407.1 | dephospho-CoA kinase | - |
| XCCCN08v2_RS05210 | 1236701..1237564 | - | 864 | WP_075285408.1 | A24 family peptidase | - |
| XCCCN08v2_RS05215 | 1237570..1238826 | - | 1257 | WP_075285409.1 | type II secretion system F family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1224045..1248622 | 24577 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T251464 WP_011038220.1 NZ_CP101176:c1233565-1233074 [Xanthomonas campestris pv. campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|