Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3696214..3696992 | Replicon | chromosome |
Accession | NZ_CP101174 | ||
Organism | Xanthomonas campestris pv. campestris strain CN07 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8P667 |
Locus tag | XCCCN07v2_RS16210 | Protein ID | WP_011038220.1 |
Coordinates | 3696501..3696992 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8P668 |
Locus tag | XCCCN07v2_RS16205 | Protein ID | WP_011038219.1 |
Coordinates | 3696214..3696504 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XCCCN07v2_RS16180 | 3691676..3692116 | - | 441 | WP_011038214.1 | pilin | - |
XCCCN07v2_RS16185 | 3692443..3693699 | + | 1257 | WP_011038215.1 | type II secretion system F family protein | - |
XCCCN07v2_RS16190 | 3693706..3694569 | + | 864 | WP_011038216.1 | A24 family peptidase | - |
XCCCN07v2_RS16195 | 3694583..3695206 | + | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
XCCCN07v2_RS16200 | 3695738..3696139 | + | 402 | WP_019237348.1 | SymE family type I addiction module toxin | - |
XCCCN07v2_RS16205 | 3696214..3696504 | + | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
XCCCN07v2_RS16210 | 3696501..3696992 | + | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
XCCCN07v2_RS16215 | 3697135..3698469 | - | 1335 | WP_019237347.1 | HAMP domain-containing sensor histidine kinase | - |
XCCCN07v2_RS16220 | 3698462..3699139 | - | 678 | WP_003490678.1 | response regulator transcription factor | - |
XCCCN07v2_RS16225 | 3699789..3700664 | - | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T251462 WP_011038220.1 NZ_CP101174:3696501-3696992 [Xanthomonas campestris pv. campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|