Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1293917..1294695 | Replicon | chromosome |
Accession | NZ_CP101172 | ||
Organism | Xanthomonas campestris pv. campestris strain CN06 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8P667 |
Locus tag | XCCCN06v2_RS05450 | Protein ID | WP_011038220.1 |
Coordinates | 1293917..1294408 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8P668 |
Locus tag | XCCCN06v2_RS05455 | Protein ID | WP_011038219.1 |
Coordinates | 1294405..1294695 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XCCCN06v2_RS05435 | 1290245..1291120 | + | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
XCCCN06v2_RS05440 | 1291770..1292447 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
XCCCN06v2_RS05445 | 1292440..1293774 | + | 1335 | WP_162808569.1 | HAMP domain-containing sensor histidine kinase | - |
XCCCN06v2_RS05450 | 1293917..1294408 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
XCCCN06v2_RS05455 | 1294405..1294695 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
XCCCN06v2_RS05460 | 1294770..1295171 | - | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
XCCCN06v2_RS05465 | 1295314..1296422 | + | 1109 | WP_087942068.1 | IS3 family transposase | - |
XCCCN06v2_RS05470 | 1296907..1297530 | - | 624 | WP_075285407.1 | dephospho-CoA kinase | - |
XCCCN06v2_RS05475 | 1297544..1298407 | - | 864 | WP_075285408.1 | A24 family peptidase | - |
XCCCN06v2_RS05480 | 1298413..1299669 | - | 1257 | WP_075285409.1 | type II secretion system F family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1285888..1299669 | 13781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T251460 WP_011038220.1 NZ_CP101172:c1294408-1293917 [Xanthomonas campestris pv. campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|