Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1280036..1280814 | Replicon | chromosome |
| Accession | NZ_CP101170 | ||
| Organism | Xanthomonas campestris pv. campestris strain CN05 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | Q8P667 |
| Locus tag | XCCCN05v2_RS05350 | Protein ID | WP_011038220.1 |
| Coordinates | 1280036..1280527 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | Q8P668 |
| Locus tag | XCCCN05v2_RS05355 | Protein ID | WP_011038219.1 |
| Coordinates | 1280524..1280814 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XCCCN05v2_RS05335 | 1276364..1277239 | + | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| XCCCN05v2_RS05340 | 1277889..1278566 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
| XCCCN05v2_RS05345 | 1278559..1279893 | + | 1335 | WP_019237347.1 | HAMP domain-containing sensor histidine kinase | - |
| XCCCN05v2_RS05350 | 1280036..1280527 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
| XCCCN05v2_RS05355 | 1280524..1280814 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
| XCCCN05v2_RS05360 | 1280889..1281290 | - | 402 | WP_019237348.1 | SymE family type I addiction module toxin | - |
| XCCCN05v2_RS05365 | 1281822..1282445 | - | 624 | WP_228422810.1 | dephospho-CoA kinase | - |
| XCCCN05v2_RS05370 | 1282459..1283322 | - | 864 | WP_223646361.1 | A24 family peptidase | - |
| XCCCN05v2_RS05375 | 1283329..1284588 | - | 1260 | WP_223646360.1 | type II secretion system F family protein | - |
| XCCCN05v2_RS05380 | 1284942..1285382 | + | 441 | WP_223646359.1 | pilin | - |
| XCCCN05v2_RS05385 | 1285502..1285633 | + | 132 | Protein_1045 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1246495..1283616 | 37121 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T251458 WP_011038220.1 NZ_CP101170:c1280527-1280036 [Xanthomonas campestris pv. campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|