Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3782984..3783762 | Replicon | chromosome |
| Accession | NZ_CP101169 | ||
| Organism | Xanthomonas campestris pv. campestris strain CN02 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | Q8P667 |
| Locus tag | XCCCN02v2_RS16940 | Protein ID | WP_011038220.1 |
| Coordinates | 3783271..3783762 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | Q8P668 |
| Locus tag | XCCCN02v2_RS16935 | Protein ID | WP_011038219.1 |
| Coordinates | 3782984..3783274 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XCCCN02v2_RS16910 | 3778010..3779266 | + | 1257 | WP_075285409.1 | type II secretion system F family protein | - |
| XCCCN02v2_RS16915 | 3779272..3780135 | + | 864 | WP_075285408.1 | A24 family peptidase | - |
| XCCCN02v2_RS16920 | 3780149..3780772 | + | 624 | WP_075285407.1 | dephospho-CoA kinase | - |
| XCCCN02v2_RS16930 | 3782508..3782909 | + | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| XCCCN02v2_RS16935 | 3782984..3783274 | + | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
| XCCCN02v2_RS16940 | 3783271..3783762 | + | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
| XCCCN02v2_RS16945 | 3783905..3785239 | - | 1335 | WP_162808569.1 | HAMP domain-containing sensor histidine kinase | - |
| XCCCN02v2_RS16950 | 3785232..3785909 | - | 678 | WP_003490678.1 | response regulator transcription factor | - |
| XCCCN02v2_RS16955 | 3786559..3787434 | - | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T251457 WP_011038220.1 NZ_CP101169:3783271-3783762 [Xanthomonas campestris pv. campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|