Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 416673..417039 Replicon chromosome
Accession NZ_CP101169
Organism Xanthomonas campestris pv. campestris strain CN02

Toxin (Protein)


Gene name EcnB Uniprot ID G0CKD4
Locus tag XCCCN02v2_RS01815 Protein ID WP_011270059.1
Coordinates 416905..417039 (+) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID Q8P3Z2
Locus tag XCCCN02v2_RS01810 Protein ID WP_011038999.1
Coordinates 416673..416825 (+) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XCCCN02v2_RS01780 411845..412528 - 684 WP_070693788.1 dTMP kinase -
XCCCN02v2_RS01785 412863..413405 - 543 WP_075286291.1 GTPase -
XCCCN02v2_RS01790 413402..414319 - 918 WP_075286290.1 hypothetical protein -
XCCCN02v2_RS01795 414422..414781 - 360 WP_011039002.1 hypothetical protein -
XCCCN02v2_RS01800 414864..415325 - 462 WP_012439505.1 roadblock/LC7 domain-containing protein -
XCCCN02v2_RS01805 415639..416562 + 924 WP_040942405.1 arginase -
XCCCN02v2_RS01810 416673..416825 + 153 WP_011038999.1 entericidin A/B family lipoprotein Antitoxin
XCCCN02v2_RS01815 416905..417039 + 135 WP_011270059.1 entericidin A/B family lipoprotein Toxin
XCCCN02v2_RS01820 417273..417482 + 210 WP_011038998.1 CsbD family protein -
XCCCN02v2_RS01825 417642..418931 + 1290 WP_029217012.1 tryptophan--tRNA ligase -
XCCCN02v2_RS01830 419015..419960 + 946 Protein_358 MBL fold metallo-hydrolase -
XCCCN02v2_RS01835 420125..421777 + 1653 WP_162808741.1 M28 family metallopeptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-42)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4431.27 Da        Isoelectric Point: 9.3487

>T251456 WP_011270059.1 NZ_CP101169:416905-417039 [Xanthomonas campestris pv. campestris]
MKRAIALLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5173.15 Da        Isoelectric Point: 8.2782

>AT251456 WP_011038999.1 NZ_CP101169:416673-416825 [Xanthomonas campestris pv. campestris]
MKRLLTLMVLGLFSAGMMTGCNTMAGAGKDMQGAGDKVEKTADKCSDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2XDQ0

Antitoxin

Source ID Structure
AlphaFold DB Q8P3Z2

References