Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2350371..2351346 | Replicon | chromosome |
Accession | NZ_CP101135 | ||
Organism | Bacillus paranthracis strain Bt C4 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | B7HS47 |
Locus tag | NLJ82_RS11975 | Protein ID | WP_002027714.1 |
Coordinates | 2350371..2351108 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | NLJ82_RS11980 | Protein ID | WP_000588712.1 |
Coordinates | 2351221..2351346 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLJ82_RS11945 (NLJ82_11945) | 2345446..2346156 | + | 711 | WP_000787475.1 | class I SAM-dependent methyltransferase | - |
NLJ82_RS11950 (NLJ82_11950) | 2346276..2346683 | + | 408 | WP_000072484.1 | VOC family protein | - |
NLJ82_RS11955 (NLJ82_11955) | 2346789..2346881 | + | 93 | Protein_2275 | methyltransferase | - |
NLJ82_RS11960 (NLJ82_11960) | 2347003..2348688 | - | 1686 | WP_002027713.1 | alpha-keto acid decarboxylase family protein | - |
NLJ82_RS11965 (NLJ82_11965) | 2348795..2349277 | + | 483 | WP_000191904.1 | MarR family transcriptional regulator | - |
NLJ82_RS11970 (NLJ82_11970) | 2349445..2350182 | + | 738 | WP_000594123.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
NLJ82_RS11975 (NLJ82_11975) | 2350371..2351108 | + | 738 | WP_002027714.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NLJ82_RS11980 (NLJ82_11980) | 2351221..2351346 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
NLJ82_RS11985 (NLJ82_11985) | 2351422..2351598 | + | 177 | WP_000852623.1 | stage II sporulation protein SB | - |
NLJ82_RS11990 (NLJ82_11990) | 2351742..2353211 | + | 1470 | WP_000287524.1 | beta-Ala-His dipeptidase | - |
NLJ82_RS11995 (NLJ82_11995) | 2353288..2353659 | - | 372 | WP_000670601.1 | DUF5065 family protein | - |
NLJ82_RS12000 (NLJ82_12000) | 2353802..2354395 | + | 594 | WP_000265892.1 | SGNH/GDSL hydrolase family protein | - |
NLJ82_RS12005 (NLJ82_12005) | 2354617..2355150 | + | 534 | WP_000438320.1 | sigma-70 family RNA polymerase sigma factor | - |
NLJ82_RS12010 (NLJ82_12010) | 2355140..2355967 | + | 828 | WP_001060777.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28415.15 Da Isoelectric Point: 8.2672
>T251452 WP_002027714.1 NZ_CP101135:2350371-2351108 [Bacillus paranthracis]
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTSIIQNVNPVVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTSIIQNVNPVVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M9H7T3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |