Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 252397..253039 | Replicon | chromosome |
Accession | NZ_CP101135 | ||
Organism | Bacillus paranthracis strain Bt C4 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | NLJ82_RS01415 | Protein ID | WP_000635963.1 |
Coordinates | 252689..253039 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | NLJ82_RS01410 | Protein ID | WP_000004570.1 |
Coordinates | 252397..252684 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLJ82_RS01385 (NLJ82_01385) | 247723..248685 | + | 963 | WP_000961150.1 | UV DNA damage repair endonuclease UvsE | - |
NLJ82_RS01390 (NLJ82_01390) | 248678..249250 | - | 573 | WP_001993582.1 | rhomboid family intramembrane serine protease | - |
NLJ82_RS01395 (NLJ82_01395) | 249343..249702 | + | 360 | WP_000635037.1 | holo-ACP synthase | - |
NLJ82_RS01400 (NLJ82_01400) | 249859..250809 | + | 951 | WP_025991724.1 | outer membrane lipoprotein carrier protein LolA | - |
NLJ82_RS01405 (NLJ82_01405) | 250928..252097 | + | 1170 | WP_000390601.1 | alanine racemase | - |
NLJ82_RS01410 (NLJ82_01410) | 252397..252684 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
NLJ82_RS01415 (NLJ82_01415) | 252689..253039 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NLJ82_RS01420 (NLJ82_01420) | 253107..255275 | + | 2169 | WP_000450602.1 | Tex family protein | - |
NLJ82_RS01425 (NLJ82_01425) | 255333..255449 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
NLJ82_RS01430 (NLJ82_01430) | 255645..256103 | + | 459 | WP_000344246.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T251451 WP_000635963.1 NZ_CP101135:252689-253039 [Bacillus paranthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |