Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1433840..1434476 | Replicon | chromosome |
| Accession | NZ_CP101130 | ||
| Organism | Bacillus sp. KRF7 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | NL113_RS07100 | Protein ID | WP_003179128.1 |
| Coordinates | 1433840..1434190 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | M5PDU2 |
| Locus tag | NL113_RS07105 | Protein ID | WP_006638778.1 |
| Coordinates | 1434195..1434476 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL113_RS07060 | 1428882..1429481 | - | 600 | WP_006638786.1 | PP2C family serine/threonine-protein phosphatase | - |
| NL113_RS07065 | 1429478..1430269 | - | 792 | WP_006638785.1 | RNA polymerase sigma factor SigB | - |
| NL113_RS07070 | 1430235..1430717 | - | 483 | WP_006638784.1 | anti-sigma B factor RsbW | - |
| NL113_RS07075 | 1430717..1431043 | - | 327 | WP_006638783.1 | anti-sigma factor antagonist | - |
| NL113_RS07080 | 1431102..1432109 | - | 1008 | WP_006638782.1 | PP2C family protein-serine/threonine phosphatase | - |
| NL113_RS07085 | 1432120..1432521 | - | 402 | WP_006638781.1 | anti-sigma regulatory factor | - |
| NL113_RS07090 | 1432524..1432889 | - | 366 | WP_006638780.1 | STAS domain-containing protein | - |
| NL113_RS07095 | 1432893..1433720 | - | 828 | WP_006638779.1 | RsbT co-antagonist protein RsbRA | - |
| NL113_RS07100 | 1433840..1434190 | - | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NL113_RS07105 | 1434195..1434476 | - | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
| NL113_RS07110 | 1434581..1435756 | - | 1176 | WP_006638777.1 | alanine racemase | - |
| NL113_RS07115 | 1435971..1436987 | - | 1017 | WP_087962525.1 | outer membrane lipoprotein carrier protein LolA | - |
| NL113_RS07120 | 1437269..1437868 | + | 600 | WP_006638775.1 | rhomboid family intramembrane serine protease | - |
| NL113_RS07125 | 1437865..1439346 | - | 1482 | WP_040348458.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T251450 WP_003179128.1 NZ_CP101130:c1434190-1433840 [Bacillus sp. KRF7]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M5PDU2 |