Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 1433840..1434476 Replicon chromosome
Accession NZ_CP101130
Organism Bacillus sp. KRF7

Toxin (Protein)


Gene name mazF Uniprot ID M5P3Q9
Locus tag NL113_RS07100 Protein ID WP_003179128.1
Coordinates 1433840..1434190 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID M5PDU2
Locus tag NL113_RS07105 Protein ID WP_006638778.1
Coordinates 1434195..1434476 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL113_RS07060 1428882..1429481 - 600 WP_006638786.1 PP2C family serine/threonine-protein phosphatase -
NL113_RS07065 1429478..1430269 - 792 WP_006638785.1 RNA polymerase sigma factor SigB -
NL113_RS07070 1430235..1430717 - 483 WP_006638784.1 anti-sigma B factor RsbW -
NL113_RS07075 1430717..1431043 - 327 WP_006638783.1 anti-sigma factor antagonist -
NL113_RS07080 1431102..1432109 - 1008 WP_006638782.1 PP2C family protein-serine/threonine phosphatase -
NL113_RS07085 1432120..1432521 - 402 WP_006638781.1 anti-sigma regulatory factor -
NL113_RS07090 1432524..1432889 - 366 WP_006638780.1 STAS domain-containing protein -
NL113_RS07095 1432893..1433720 - 828 WP_006638779.1 RsbT co-antagonist protein RsbRA -
NL113_RS07100 1433840..1434190 - 351 WP_003179128.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
NL113_RS07105 1434195..1434476 - 282 WP_006638778.1 hypothetical protein Antitoxin
NL113_RS07110 1434581..1435756 - 1176 WP_006638777.1 alanine racemase -
NL113_RS07115 1435971..1436987 - 1017 WP_087962525.1 outer membrane lipoprotein carrier protein LolA -
NL113_RS07120 1437269..1437868 + 600 WP_006638775.1 rhomboid family intramembrane serine protease -
NL113_RS07125 1437865..1439346 - 1482 WP_040348458.1 PH domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12990.03 Da        Isoelectric Point: 5.7234

>T251450 WP_003179128.1 NZ_CP101130:c1434190-1433840 [Bacillus sp. KRF7]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10649.03 Da        Isoelectric Point: 4.6920

>AT251450 WP_006638778.1 NZ_CP101130:c1434476-1434195 [Bacillus sp. KRF7]
MSESSATTEILIRLPEALVSELDGVVMQDNGSRNELIYQATKMYLRERKNRQIRESMRRGYMEMAKINLNISSEAQFAEY
EAENTVERLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6I7FHI4

Antitoxin

Source ID Structure
AlphaFold DB M5PDU2

References