Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 7051368..7051899 | Replicon | chromosome |
Accession | NZ_CP101125 | ||
Organism | Pseudomonas nunensis strain In5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A6L5BQB4 |
Locus tag | NK667_RS31220 | Protein ID | WP_054616769.1 |
Coordinates | 7051368..7051670 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A6L5BNJ0 |
Locus tag | NK667_RS31225 | Protein ID | WP_054616768.1 |
Coordinates | 7051660..7051899 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NK667_RS31205 (NK667_31205) | 7047571..7049190 | + | 1620 | WP_054616772.1 | DUF2300 domain-containing protein | - |
NK667_RS31210 (NK667_31210) | 7049194..7050003 | + | 810 | WP_054616771.1 | DUF2135 domain-containing protein | - |
NK667_RS31215 (NK667_31215) | 7050174..7051286 | + | 1113 | WP_054616770.1 | endonuclease NucS | - |
NK667_RS31220 (NK667_31220) | 7051368..7051670 | - | 303 | WP_054616769.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NK667_RS31225 (NK667_31225) | 7051660..7051899 | - | 240 | WP_054616768.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NK667_RS31230 (NK667_31230) | 7052162..7052800 | - | 639 | WP_054616767.1 | retron Ec78 anti-phage system effector HNH endonuclease PtuB | - |
NK667_RS31235 (NK667_31235) | 7052802..7054259 | - | 1458 | WP_054616766.1 | AAA family ATPase | - |
NK667_RS31240 (NK667_31240) | 7054770..7055621 | - | 852 | WP_054616765.1 | hypothetical protein | - |
NK667_RS31245 (NK667_31245) | 7055943..7056143 | + | 201 | WP_054616764.1 | AlpA family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11827.60 Da Isoelectric Point: 9.7094
>T251448 WP_054616769.1 NZ_CP101125:c7051670-7051368 [Pseudomonas nunensis]
MTYSLEFDRRALKEWNKLGDTLRQQFKKKLAEVLENPRIEANRLRQLPDCYKLKLRSAGYRLIYQVLDQEVVVFVVAIGK
REREAAYQDAQERIGQQPAD
MTYSLEFDRRALKEWNKLGDTLRQQFKKKLAEVLENPRIEANRLRQLPDCYKLKLRSAGYRLIYQVLDQEVVVFVVAIGK
REREAAYQDAQERIGQQPAD
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L5BQB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L5BNJ0 |