Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5911197..5911840 | Replicon | chromosome |
Accession | NZ_CP101125 | ||
Organism | Pseudomonas nunensis strain In5 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NK667_RS25995 | Protein ID | WP_054616542.1 |
Coordinates | 5911658..5911840 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NK667_RS25990 | Protein ID | WP_054047901.1 |
Coordinates | 5911197..5911598 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NK667_RS25970 (NK667_25970) | 5906265..5907584 | - | 1320 | WP_054616540.1 | LLM class flavin-dependent oxidoreductase | - |
NK667_RS25975 (NK667_25975) | 5907587..5909833 | - | 2247 | WP_054616541.1 | TonB-dependent receptor | - |
NK667_RS25980 (NK667_25980) | 5910040..5911080 | + | 1041 | WP_054047806.1 | LacI family DNA-binding transcriptional regulator | - |
NK667_RS25985 (NK667_25985) | 5911094..5911225 | - | 132 | Protein_5128 | DUF4381 domain-containing protein | - |
NK667_RS25990 (NK667_25990) | 5911197..5911598 | - | 402 | WP_054047901.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NK667_RS25995 (NK667_25995) | 5911658..5911840 | - | 183 | WP_054616542.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NK667_RS26000 (NK667_26000) | 5911947..5912861 | - | 915 | WP_054616543.1 | LysR family transcriptional regulator | - |
NK667_RS26005 (NK667_26005) | 5912991..5913731 | + | 741 | WP_054616544.1 | SDR family oxidoreductase | - |
NK667_RS26010 (NK667_26010) | 5913756..5914643 | + | 888 | WP_054616545.1 | SDR family oxidoreductase | - |
NK667_RS26015 (NK667_26015) | 5914767..5915024 | + | 258 | WP_054616546.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6834.95 Da Isoelectric Point: 10.7495
>T251444 WP_054616542.1 NZ_CP101125:c5911840-5911658 [Pseudomonas nunensis]
MRSREMIRMIEGDGWYLVAVKGSHHQYKHSHKPGRVTIKHPDSDLPKGTINSILKQAGLK
MRSREMIRMIEGDGWYLVAVKGSHHQYKHSHKPGRVTIKHPDSDLPKGTINSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14582.36 Da Isoelectric Point: 4.4829
>AT251444 WP_054047901.1 NZ_CP101125:c5911598-5911197 [Pseudomonas nunensis]
MKFPVVLHKDADSEYGVIVPDVPGCFSAGSTVAQAFENVKEALSLHYEGLVADGDPLPQVREIDAHLDNPDYAGGVWGVV
EFDITPYFGKAVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
MKFPVVLHKDADSEYGVIVPDVPGCFSAGSTVAQAFENVKEALSLHYEGLVADGDPLPQVREIDAHLDNPDYAGGVWGVV
EFDITPYFGKAVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|