Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3049885..3050404 | Replicon | chromosome |
Accession | NZ_CP101125 | ||
Organism | Pseudomonas nunensis strain In5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A6L5C1Y7 |
Locus tag | NK667_RS13035 | Protein ID | WP_054615008.1 |
Coordinates | 3049885..3050166 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NK667_RS13040 | Protein ID | WP_054615009.1 |
Coordinates | 3050156..3050404 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NK667_RS13005 (NK667_13005) | 3045080..3045844 | - | 765 | WP_054615004.1 | IclR family transcriptional regulator | - |
NK667_RS13010 (NK667_13010) | 3045991..3046380 | - | 390 | WP_054615005.1 | RidA family protein | - |
NK667_RS13015 (NK667_13015) | 3046417..3047208 | - | 792 | WP_054615006.1 | amino acid ABC transporter ATP-binding protein | - |
NK667_RS13020 (NK667_13020) | 3047205..3047867 | - | 663 | WP_054046640.1 | amino acid ABC transporter permease | - |
NK667_RS13025 (NK667_13025) | 3047877..3048539 | - | 663 | WP_054046642.1 | amino acid ABC transporter permease | - |
NK667_RS13030 (NK667_13030) | 3048717..3049565 | - | 849 | WP_054615007.1 | transporter substrate-binding domain-containing protein | - |
NK667_RS13035 (NK667_13035) | 3049885..3050166 | - | 282 | WP_054615008.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NK667_RS13040 (NK667_13040) | 3050156..3050404 | - | 249 | WP_054615009.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NK667_RS13045 (NK667_13045) | 3050714..3051145 | + | 432 | WP_054615010.1 | thioredoxin family protein | - |
NK667_RS13050 (NK667_13050) | 3051288..3052847 | - | 1560 | WP_054615011.1 | TerC family protein | - |
NK667_RS13055 (NK667_13055) | 3053232..3054098 | - | 867 | WP_054615012.1 | LysR substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10880.66 Da Isoelectric Point: 10.4586
>T251442 WP_054615008.1 NZ_CP101125:c3050166-3049885 [Pseudomonas nunensis]
MTYELEFSEKAWKEWKKLGVNLREQFKNKLQERLVHPHVPADRLHGLGNAYKIKLRSAGYRLVYRVKDEVLIVTVIAVGK
RERGGVYKDAGER
MTYELEFSEKAWKEWKKLGVNLREQFKNKLQERLVHPHVPADRLHGLGNAYKIKLRSAGYRLVYRVKDEVLIVTVIAVGK
RERGGVYKDAGER
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|