Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1853256..1854032 | Replicon | chromosome |
Accession | NZ_CP101124 | ||
Organism | Staphylococcus aureus subsp. aureus RN4220 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NMK49_RS08895 | Protein ID | WP_000031108.1 |
Coordinates | 1853256..1853408 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NMK49_RS08900 | Protein ID | WP_001251224.1 |
Coordinates | 1853433..1854032 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK49_RS08880 | 1849219..1850040 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
NMK49_RS08885 | 1850503..1851888 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
NMK49_RS08890 | 1852084..1852479 | - | 396 | WP_000901021.1 | hypothetical protein | - |
NMK49_RS08895 | 1853256..1853408 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NMK49_RS08900 | 1853433..1854032 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NMK49_RS08905 | 1854191..1854661 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NMK49_RS08910 | 1854666..1855793 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NMK49_RS08915 | 1855944..1856666 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NMK49_RS08920 | 1856659..1858116 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1805915..1861130 | 55215 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T251435 WP_000031108.1 NZ_CP101124:c1853408-1853256 [Staphylococcus aureus subsp. aureus RN4220]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT251435 WP_001251224.1 NZ_CP101124:c1854032-1853433 [Staphylococcus aureus subsp. aureus RN4220]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|