251433

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 811819..812296 Replicon chromosome
Accession NZ_CP101124
Organism Staphylococcus aureus subsp. aureus RN4220

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag NMK49_RS03875 Protein ID WP_000052078.1
Coordinates 811819..812007 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NMK49_RS03880 Protein ID WP_001059690.1
Coordinates 812036..812296 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK49_RS03845 807860..808330 + 471 WP_000824472.1 hypothetical protein -
NMK49_RS03850 808671..809357 + 687 WP_001548082.1 thermonuclease family protein -
NMK49_RS03855 809714..809914 + 201 WP_001059082.1 cold-shock protein -
NMK49_RS03860 810410..810628 - 219 WP_000005886.1 hypothetical protein -
NMK49_RS03865 810690..810974 - 285 WP_001004395.1 hypothetical protein -
NMK49_RS03870 811062..811631 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NMK49_RS03875 811819..812007 - 189 WP_000052078.1 hypothetical protein Toxin
NMK49_RS03880 812036..812296 - 261 WP_001059690.1 hypothetical protein Antitoxin
NMK49_RS03885 812637..812840 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NMK49_RS03890 812837..813073 - 237 WP_000368687.1 hypothetical protein -
NMK49_RS03895 813298..813879 + 582 WP_001140693.1 histidine phosphatase family protein -
NMK49_RS03900 813952..814569 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NMK49_RS03905 814724..815218 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NMK49_RS03910 815617..816039 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NMK49_RS03915 816187..816903 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T251433 WP_000052078.1 NZ_CP101124:c812007-811819 [Staphylococcus aureus subsp. aureus RN4220]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT251433 WP_001059690.1 NZ_CP101124:c812296-812036 [Staphylococcus aureus subsp. aureus RN4220]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References