Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2822029..2822558 Replicon chromosome
Accession NZ_CP101123
Organism Staphylococcus aureus strain MN8

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag NLA26_RS14045 Protein ID WP_000621176.1
Coordinates 2822196..2822558 (+) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag NLA26_RS14040 Protein ID WP_000948331.1
Coordinates 2822029..2822199 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLA26_RS14010 (2817065) 2817065..2817625 + 561 WP_001092414.1 K(+)-transporting ATPase subunit C -
NLA26_RS14015 (2817834) 2817834..2818313 + 480 WP_001287082.1 hypothetical protein -
NLA26_RS14020 (2818306) 2818306..2819883 + 1578 WP_001294646.1 PH domain-containing protein -
NLA26_RS14025 (2819876) 2819876..2820367 + 492 WP_001286801.1 PH domain-containing protein -
NLA26_RS14030 (2820371) 2820371..2820730 + 360 WP_000581197.1 holo-ACP synthase -
NLA26_RS14035 (2820796) 2820796..2821944 + 1149 WP_001281140.1 alanine racemase -
NLA26_RS14040 (2822029) 2822029..2822199 + 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
NLA26_RS14045 (2822196) 2822196..2822558 + 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NLA26_RS14050 (2822907) 2822907..2823908 + 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
NLA26_RS14055 (2824027) 2824027..2824353 + 327 WP_001052491.1 anti-sigma factor antagonist -
NLA26_RS14060 (2824355) 2824355..2824834 + 480 WP_001190825.1 anti-sigma B factor RsbW -
NLA26_RS14065 (2824809) 2824809..2825579 + 771 WP_001041107.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T251431 WP_000621176.1 NZ_CP101123:2822196-2822558 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT251431 WP_000948331.1 NZ_CP101123:2822029-2822199 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References