Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1293840..1294317 Replicon chromosome
Accession NZ_CP101123
Organism Staphylococcus aureus strain MN8

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NLA26_RS06645 Protein ID WP_000052076.1
Coordinates 1294129..1294317 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NLA26_RS06640 Protein ID WP_001059690.1
Coordinates 1293840..1294100 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLA26_RS06605 1289232..1289948 - 717 WP_000150036.1 type I 3-dehydroquinate dehydratase -
NLA26_RS06610 1290096..1290518 + 423 WP_000974455.1 organic hydroperoxide resistance protein -
NLA26_RS06615 1290917..1291411 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
NLA26_RS06620 1291567..1292184 + 618 WP_000255545.1 LysE/ArgO family amino acid transporter -
NLA26_RS06625 1292257..1292838 - 582 WP_001140696.1 histidine phosphatase family protein -
NLA26_RS06630 1293063..1293299 + 237 WP_000368687.1 hypothetical protein -
NLA26_RS06635 1293296..1293499 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NLA26_RS06640 1293840..1294100 + 261 WP_001059690.1 hypothetical protein Antitoxin
NLA26_RS06645 1294129..1294317 + 189 WP_000052076.1 hypothetical protein Toxin
NLA26_RS06650 1294505..1295074 + 570 WP_001106663.1 lipoprotein N-acylation protein LnsA -
NLA26_RS06655 1295162..1295446 + 285 WP_001004401.1 hypothetical protein -
NLA26_RS06660 1295508..1295726 + 219 WP_000005879.1 hypothetical protein -
NLA26_RS06665 1296223..1296423 - 201 WP_001059082.1 cold-shock protein -
NLA26_RS06670 1296780..1297466 - 687 WP_001574556.1 thermonuclease family protein -
NLA26_RS06675 1297807..1298364 - 558 WP_000824491.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T251424 WP_000052076.1 NZ_CP101123:1294129-1294317 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT251424 WP_001059690.1 NZ_CP101123:1293840-1294100 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References