Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 94677..95465 Replicon chromosome
Accession NZ_CP101123
Organism Staphylococcus aureus strain MN8

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag NLA26_RS00520 Protein ID WP_000525004.1
Coordinates 94677..95138 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag NLA26_RS00525 Protein ID WP_000333630.1
Coordinates 95151..95465 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLA26_RS00495 (90263) 90263..90793 + 531 WP_000184383.1 acyl-CoA thioesterase -
NLA26_RS00500 (91053) 91053..92198 - 1146 WP_001245443.1 radical SAM/CxCxxxxC motif protein YfkAB -
NLA26_RS00505 (92243) 92243..93289 - 1047 WP_001145722.1 tyrosine-type recombinase/integrase -
NLA26_RS00510 (93402) 93402..93581 + 180 WP_000337827.1 hypothetical protein -
NLA26_RS00515 (93561) 93561..94493 - 933 WP_000392183.1 hypothetical protein -
NLA26_RS00520 (94677) 94677..95138 - 462 WP_000525004.1 hypothetical protein Toxin
NLA26_RS00525 (95151) 95151..95465 - 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
NLA26_RS00530 (95617) 95617..95853 + 237 WP_001121116.1 helix-turn-helix transcriptional regulator -
NLA26_RS00535 (95867) 95867..96046 + 180 WP_000438352.1 hypothetical protein -
NLA26_RS00540 (96147) 96147..96629 - 483 WP_000394410.1 hypothetical protein -
NLA26_RS00545 (97075) 97075..97260 + 186 WP_000933365.1 helix-turn-helix transcriptional regulator -
NLA26_RS00550 (97262) 97262..98002 + 741 WP_001148589.1 phage antirepressor KilAC domain-containing protein -
NLA26_RS00555 (98178) 98178..98408 - 231 WP_000395455.1 hypothetical protein -
NLA26_RS00560 (98479) 98479..98700 + 222 WP_000594789.1 hypothetical protein -
NLA26_RS00565 (98693) 98693..98854 + 162 WP_000066011.1 DUF1270 domain-containing protein -
NLA26_RS00570 (98951) 98951..99211 + 261 WP_000291090.1 DUF1108 family protein -
NLA26_RS00575 (99221) 99221..99442 + 222 WP_001077280.1 DUF2483 family protein -
NLA26_RS00580 (99435) 99435..100058 + 624 WP_000139720.1 DUF1071 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 92243..136227 43984


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T251418 WP_000525004.1 NZ_CP101123:c95138-94677 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT251418 WP_000333630.1 NZ_CP101123:c95465-95151 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References