Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 487041..487680 | Replicon | chromosome |
| Accession | NZ_CP101115 | ||
| Organism | Acinetobacter sp. Z1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NGC85_RS02340 | Protein ID | WP_254804709.1 |
| Coordinates | 487285..487680 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NGC85_RS02335 | Protein ID | WP_034710568.1 |
| Coordinates | 487041..487298 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NGC85_RS02310 (NGC85_02310) | 482067..482432 | + | 366 | WP_004641032.1 | 50S ribosomal protein L17 | - |
| NGC85_RS02315 (NGC85_02315) | 482625..483122 | + | 498 | WP_254804706.1 | GNAT family N-acetyltransferase | - |
| NGC85_RS02320 (NGC85_02320) | 483524..485014 | + | 1491 | WP_254804707.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NGC85_RS02325 (NGC85_02325) | 485139..485633 | + | 495 | WP_254804708.1 | DUF2059 domain-containing protein | - |
| NGC85_RS02330 (NGC85_02330) | 485681..486853 | - | 1173 | WP_005059702.1 | acyl-CoA dehydrogenase family protein | - |
| NGC85_RS02335 (NGC85_02335) | 487041..487298 | + | 258 | WP_034710568.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NGC85_RS02340 (NGC85_02340) | 487285..487680 | + | 396 | WP_254804709.1 | hypothetical protein | Toxin |
| NGC85_RS02345 (NGC85_02345) | 487889..488110 | + | 222 | WP_005059699.1 | hypothetical protein | - |
| NGC85_RS02350 (NGC85_02350) | 488454..489539 | + | 1086 | WP_005059697.1 | hypothetical protein | - |
| NGC85_RS02355 (NGC85_02355) | 489613..490203 | + | 591 | WP_005059696.1 | rhombosortase | - |
| NGC85_RS02360 (NGC85_02360) | 490360..492570 | + | 2211 | WP_254804710.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 15727.80 Da Isoelectric Point: 9.9997
>T251412 WP_254804709.1 NZ_CP101115:487285-487680 [Acinetobacter sp. Z1]
MSMASRLFELQYSRFSIVLQLFVFLTISILSYQLLHMMLWLLSLGIMAFAWFKLSKQPSIIRFEYLDQHIWSFEFSDKNL
AIQRLKITKIIDHKAYVSIHIADSSCKTYIIWWDQLSYLQWKNLKLLAKLI
MSMASRLFELQYSRFSIVLQLFVFLTISILSYQLLHMMLWLLSLGIMAFAWFKLSKQPSIIRFEYLDQHIWSFEFSDKNL
AIQRLKITKIIDHKAYVSIHIADSSCKTYIIWWDQLSYLQWKNLKLLAKLI
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|