Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 779136..779683 Replicon chromosome
Accession NZ_CP101114
Organism Bartonella harrusi strain 117A

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag NMK50_RS03555 Protein ID WP_254770784.1
Coordinates 779357..779683 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag NMK50_RS03550 Protein ID WP_254770785.1
Coordinates 779136..779360 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK50_RS03500 (NMK50_03500) 774205..775416 + 1212 WP_254770899.1 AI-2E family transporter -
NMK50_RS03505 (NMK50_03505) 775413..776102 + 690 WP_254770900.1 DnaA regulatory inactivator HdaA -
NMK50_RS03515 (NMK50_03515) 776685..776990 + 306 WP_254770901.1 ETC complex I subunit -
NMK50_RS03525 (NMK50_03525) 777195..777587 - 393 WP_254770902.1 helix-turn-helix transcriptional regulator -
NMK50_RS03530 (NMK50_03530) 777713..777931 - 219 WP_254770903.1 hypothetical protein -
NMK50_RS03535 (NMK50_03535) 777924..778130 - 207 WP_254770904.1 hypothetical protein -
NMK50_RS03540 (NMK50_03540) 778063..778291 - 229 Protein_657 hypothetical protein -
NMK50_RS03545 (NMK50_03545) 778288..778950 - 663 WP_254770786.1 lysozyme -
NMK50_RS03550 (NMK50_03550) 779136..779360 + 225 WP_254770785.1 antitoxin MazE family protein Antitoxin
NMK50_RS03555 (NMK50_03555) 779357..779683 + 327 WP_254770784.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NMK50_RS03560 (NMK50_03560) 779740..780063 + 324 Protein_661 type II toxin-antitoxin system RelE/ParE family toxin -
NMK50_RS03565 (NMK50_03565) 780076..780387 + 312 WP_254770783.1 addiction module antidote protein -
NMK50_RS03570 (NMK50_03570) 780456..781766 - 1311 WP_254770906.1 contractile injection system protein, VgrG/Pvc8 family -
NMK50_RS03575 (NMK50_03575) 781763..781987 - 225 WP_254769780.1 tail protein X -
NMK50_RS03580 (NMK50_03580) 781984..782364 - 381 WP_254769779.1 phage tail protein -
NMK50_RS03585 (NMK50_03585) 782370..784505 - 2136 WP_254769778.1 phage tail tape measure protein -
NMK50_RS03590 (NMK50_03590) 784502..784564 - 63 WP_254771145.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 772342..828802 56460
- inside Prophage - - 772342..824434 52092


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

Antitoxin MazE-like

(7-72)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11787.09 Da        Isoelectric Point: 10.3224

>T251408 WP_254770784.1 NZ_CP101114:779357-779683 [Bartonella harrusi]
MKRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLIAAPLLRITIQPDAKNGLQKLSQVMIDKIMTVRCEK
VSPAFGSIHADKMVEIERCLAVFLGIVK

Download         Length: 327 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8792.12 Da        Isoelectric Point: 8.5634

>AT251408 WP_254770785.1 NZ_CP101114:779136-779360 [Bartonella harrusi]
MATMHVNERVQKHRNAQRKAGLRLMQIWVPDTRQPNFAEECRRQCRLVAKMDKTDTSMQLFMDQSLVEVDGWTE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References