Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 597001..597548 Replicon chromosome
Accession NZ_CP101114
Organism Bartonella harrusi strain 117A

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag NMK50_RS02715 Protein ID WP_254770784.1
Coordinates 597001..597327 (-) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag NMK50_RS02720 Protein ID WP_254770785.1
Coordinates 597324..597548 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK50_RS02680 (NMK50_02680) 592141..593337 + 1197 WP_254770782.1 multidrug effflux MFS transporter -
NMK50_RS02685 (NMK50_02685) 593627..593875 + 249 Protein_492 alpha/beta hydrolase -
NMK50_RS02690 (NMK50_02690) 593890..594224 + 335 Protein_493 transcriptional regulator -
NMK50_RS02695 (NMK50_02695) 594288..594815 + 528 WP_254771165.1 helix-turn-helix transcriptional regulator -
NMK50_RS02700 (NMK50_02700) 595224..596228 + 1005 Protein_495 contractile injection system protein, VgrG/Pvc8 family -
NMK50_RS02705 (NMK50_02705) 596297..596608 - 312 WP_254770783.1 addiction module antidote protein -
NMK50_RS02710 (NMK50_02710) 596621..596944 - 324 Protein_497 type II toxin-antitoxin system RelE/ParE family toxin -
NMK50_RS02715 (NMK50_02715) 597001..597327 - 327 WP_254770784.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NMK50_RS02720 (NMK50_02720) 597324..597548 - 225 WP_254770785.1 antitoxin MazE family protein Antitoxin
NMK50_RS02725 (NMK50_02725) 597734..598396 + 663 WP_254770786.1 lysozyme -
NMK50_RS02730 (NMK50_02730) 598393..598621 + 229 Protein_501 hypothetical protein -
NMK50_RS02735 (NMK50_02735) 598554..598760 + 207 WP_254770787.1 hypothetical protein -
NMK50_RS02740 (NMK50_02740) 598753..598970 + 218 Protein_503 hypothetical protein -
NMK50_RS02745 (NMK50_02745) 598992..599263 - 272 Protein_504 type II toxin-antitoxin system YafQ family toxin -
NMK50_RS02750 (NMK50_02750) 599265..599522 - 258 WP_254770788.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
NMK50_RS02755 (NMK50_02755) 599732..600123 + 392 Protein_506 helix-turn-helix domain-containing protein -
NMK50_RS02765 (NMK50_02765) 600618..601832 + 1215 WP_254770789.1 porin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

Antitoxin MazE-like

(7-72)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11787.09 Da        Isoelectric Point: 10.3224

>T251407 WP_254770784.1 NZ_CP101114:c597327-597001 [Bartonella harrusi]
MKRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLIAAPLLRITIQPDAKNGLQKLSQVMIDKIMTVRCEK
VSPAFGSIHADKMVEIERCLAVFLGIVK

Download         Length: 327 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8792.12 Da        Isoelectric Point: 8.5634

>AT251407 WP_254770785.1 NZ_CP101114:c597548-597324 [Bartonella harrusi]
MATMHVNERVQKHRNAQRKAGLRLMQIWVPDTRQPNFAEECRRQCRLVAKMDKTDTSMQLFMDQSLVEVDGWTE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References