Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 321874..322405 Replicon chromosome
Accession NZ_CP101114
Organism Bartonella harrusi strain 117A

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NMK50_RS01445 Protein ID WP_254771149.1
Coordinates 322124..322405 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag NMK50_RS01440 Protein ID WP_254770601.1
Coordinates 321874..322137 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK50_RS01420 (NMK50_01420) 317451..318995 - 1545 WP_254770598.1 phage portal protein -
NMK50_RS01425 (NMK50_01425) 318995..319243 - 249 WP_254769754.1 hypothetical protein -
NMK50_RS01430 (NMK50_01430) 319247..321175 - 1929 WP_254770599.1 phage terminase large subunit family protein -
NMK50_RS01435 (NMK50_01435) 321168..321749 - 582 WP_254770600.1 hypothetical protein -
NMK50_RS01440 (NMK50_01440) 321874..322137 + 264 WP_254770601.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NMK50_RS01445 (NMK50_01445) 322124..322405 + 282 WP_254771149.1 type II toxin-antitoxin system YafQ family toxin Toxin
NMK50_RS01450 (NMK50_01450) 322458..322736 - 279 WP_254770602.1 hypothetical protein -
NMK50_RS01455 (NMK50_01455) 322733..323458 - 726 WP_254770603.1 phage regulatory protein/antirepressor Ant -
NMK50_RS01460 (NMK50_01460) 324022..324612 - 591 WP_254771150.1 antA/AntB antirepressor family protein -
NMK50_RS01465 (NMK50_01465) 324937..325335 - 399 WP_254769748.1 type II toxin-antitoxin system VapC family toxin -
NMK50_RS01470 (NMK50_01470) 325332..325583 - 252 WP_254769747.1 type II toxin-antitoxin system PrlF family antitoxin -
NMK50_RS01475 (NMK50_01475) 325670..326209 - 540 WP_254769746.1 hypothetical protein -
NMK50_RS01480 (NMK50_01480) 326252..326572 - 321 WP_254769745.1 hypothetical protein -
NMK50_RS01485 (NMK50_01485) 326924..327106 + 183 WP_241438030.1 type II toxin-antitoxin system HicA family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 288829..349377 60548


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-82)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11212.98 Da        Isoelectric Point: 10.4159

>T251406 WP_254771149.1 NZ_CP101114:322124-322405 [Bartonella harrusi]
MRTIERTTVFKRDFKREMRGRYRHLLETDLRQIIAALANDQPLELRHHDHALTGNWKDYRDCHIRPDLVLIYRLIGQDRL
ILVRLGSHSQLNL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9589.83 Da        Isoelectric Point: 4.0785

>AT251406 WP_254770601.1 NZ_CP101114:321874-322137 [Bartonella harrusi]
MATSRMVQARVPEEIQNVANQVIQASGLSVSDVVRVLMTRIAQDKAIPSFLFQPNAATIAAFTELDEGNLKKFNSVDELF
DDLYADD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References