Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4268654..4269323 | Replicon | chromosome |
Accession | NZ_CP100765 | ||
Organism | Serratia nematodiphila strain SASK3000 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0P0QIF8 |
Locus tag | NLX84_RS20290 | Protein ID | WP_033632171.1 |
Coordinates | 4268654..4269076 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
Locus tag | NLX84_RS20295 | Protein ID | WP_004931679.1 |
Coordinates | 4269057..4269323 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX84_RS20270 (NLX84_20270) | 4264546..4265064 | + | 519 | WP_004931683.1 | flavodoxin FldB | - |
NLX84_RS20275 (NLX84_20275) | 4265099..4266463 | - | 1365 | WP_060560181.1 | cell envelope integrity protein CreD | - |
NLX84_RS20280 (NLX84_20280) | 4266544..4267962 | - | 1419 | WP_033632173.1 | two-component system sensor histidine kinase CreC | - |
NLX84_RS20285 (NLX84_20285) | 4267959..4268654 | - | 696 | WP_254734336.1 | two-component system response regulator CreB | - |
NLX84_RS20290 (NLX84_20290) | 4268654..4269076 | - | 423 | WP_033632171.1 | protein YgfX | Toxin |
NLX84_RS20295 (NLX84_20295) | 4269057..4269323 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
NLX84_RS20300 (NLX84_20300) | 4269645..4270637 | + | 993 | WP_033632169.1 | tRNA-modifying protein YgfZ | - |
NLX84_RS20305 (NLX84_20305) | 4270676..4271173 | - | 498 | WP_004931675.1 | DUF2165 domain-containing protein | - |
NLX84_RS20310 (NLX84_20310) | 4271324..4271998 | - | 675 | WP_033632168.1 | hemolysin III family protein | - |
NLX84_RS20315 (NLX84_20315) | 4272182..4272790 | + | 609 | WP_033632167.1 | HD domain-containing protein | - |
NLX84_RS20320 (NLX84_20320) | 4272831..4273757 | - | 927 | WP_015378971.1 | ribokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16518.60 Da Isoelectric Point: 10.8114
>T251403 WP_033632171.1 NZ_CP100765:c4269076-4268654 [Serratia nematodiphila]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEES
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEES
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|