Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3872375..3873031 | Replicon | chromosome |
| Accession | NZ_CP100765 | ||
| Organism | Serratia nematodiphila strain SASK3000 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A086GBH4 |
| Locus tag | NLX84_RS18415 | Protein ID | WP_033632382.1 |
| Coordinates | 3872375..3872764 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A086GBH3 |
| Locus tag | NLX84_RS18420 | Protein ID | WP_033632381.1 |
| Coordinates | 3872768..3873031 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX84_RS18400 (NLX84_18400) | 3868842..3870272 | + | 1431 | WP_033632384.1 | multidrug transporter subunit MdtD | - |
| NLX84_RS18405 (NLX84_18405) | 3870269..3871651 | + | 1383 | WP_033632383.1 | two-component system sensor histidine kinase BaeS | - |
| NLX84_RS18410 (NLX84_18410) | 3871651..3872367 | + | 717 | WP_004941568.1 | two-component system response regulator BaeR | - |
| NLX84_RS18415 (NLX84_18415) | 3872375..3872764 | - | 390 | WP_033632382.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NLX84_RS18420 (NLX84_18420) | 3872768..3873031 | - | 264 | WP_033632381.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NLX84_RS18425 (NLX84_18425) | 3873369..3873707 | + | 339 | WP_004941561.1 | YegP family protein | - |
| NLX84_RS18430 (NLX84_18430) | 3873886..3875238 | + | 1353 | WP_060560045.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
| NLX84_RS18435 (NLX84_18435) | 3875706..3876611 | + | 906 | WP_135638495.1 | lipid kinase YegS | - |
| NLX84_RS18440 (NLX84_18440) | 3876872..3877921 | + | 1050 | WP_015378749.1 | class I fructose-bisphosphate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14353.58 Da Isoelectric Point: 8.4983
>T251401 WP_033632382.1 NZ_CP100765:c3872764-3872375 [Serratia nematodiphila]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRSKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKILGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRSKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKILGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086GBH4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086GBH3 |