Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3131186..3131817 Replicon chromosome
Accession NZ_CP100765
Organism Serratia nematodiphila strain SASK3000

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NLX84_RS14980 Protein ID WP_019452963.1
Coordinates 3131186..3131584 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A086GDB9
Locus tag NLX84_RS14985 Protein ID WP_004934853.1
Coordinates 3131584..3131817 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX84_RS14955 (NLX84_14955) 3126757..3127128 + 372 WP_033632743.1 type II toxin-antitoxin system RelE/ParE family toxin -
NLX84_RS14960 (NLX84_14960) 3127125..3127427 + 303 WP_033632742.1 DNA-binding transcriptional regulator -
NLX84_RS14965 (NLX84_14965) 3127430..3127834 - 405 WP_033632741.1 flagellar protein FlhE -
NLX84_RS14970 (NLX84_14970) 3127834..3129912 - 2079 WP_033632740.1 flagellar biosynthesis protein FlhA -
NLX84_RS14975 (NLX84_14975) 3129905..3131056 - 1152 WP_021504091.1 flagellar biosynthesis protein FlhB -
NLX84_RS14980 (NLX84_14980) 3131186..3131584 - 399 WP_019452963.1 type II toxin-antitoxin system VapC family toxin Toxin
NLX84_RS14985 (NLX84_14985) 3131584..3131817 - 234 WP_004934853.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NLX84_RS14990 (NLX84_14990) 3131943..3132587 - 645 WP_004934858.1 protein phosphatase CheZ -
NLX84_RS14995 (NLX84_14995) 3132598..3132987 - 390 WP_004934862.1 chemotaxis response regulator CheY -
NLX84_RS15000 (NLX84_15000) 3133090..3134139 - 1050 WP_015378262.1 chemotaxis response regulator protein-glutamate methylesterase -
NLX84_RS15005 (NLX84_15005) 3134139..3135011 - 873 WP_025159837.1 protein-glutamate O-methyltransferase CheR -
NLX84_RS15010 (NLX84_15010) 3135040..3136665 - 1626 WP_004934871.1 methyl-accepting chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-45)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14876.02 Da        Isoelectric Point: 8.4955

>T251399 WP_019452963.1 NZ_CP100765:c3131584-3131186 [Serratia nematodiphila]
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSVTYGELVHGVEKSSRPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVDGLRLENWL

Download         Length: 399 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8837.86 Da        Isoelectric Point: 4.7954

>AT251399 WP_004934853.1 NZ_CP100765:c3131817-3131584 [Serratia nematodiphila]
MTLGSVFTNNRTQAVRLPAEVRFPDTVSKVTVRVVGKERILAPVENTWDSFFCAENEVSDDFLNERAGQHQREREEL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A086GDB9

References