Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3089310..3089938 | Replicon | chromosome |
| Accession | NZ_CP100765 | ||
| Organism | Serratia nematodiphila strain SASK3000 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0P0QK57 |
| Locus tag | NLX84_RS14730 | Protein ID | WP_015378230.1 |
| Coordinates | 3089310..3089513 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A086GDG8 |
| Locus tag | NLX84_RS14735 | Protein ID | WP_015378231.1 |
| Coordinates | 3089525..3089938 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX84_RS14725 (NLX84_14725) | 3085175..3089146 | + | 3972 | WP_033632771.1 | trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase | - |
| NLX84_RS14730 (NLX84_14730) | 3089310..3089513 | + | 204 | WP_015378230.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NLX84_RS14735 (NLX84_14735) | 3089525..3089938 | + | 414 | WP_015378231.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NLX84_RS14740 (NLX84_14740) | 3089968..3090720 | - | 753 | WP_033632770.1 | L-cystine ABC transporter ATP-binding protein TcyN | - |
| NLX84_RS14745 (NLX84_14745) | 3090724..3091386 | - | 663 | WP_015378233.1 | cystine ABC transporter permease | - |
| NLX84_RS14750 (NLX84_14750) | 3091386..3092186 | - | 801 | WP_135638309.1 | cystine ABC transporter substrate-binding protein | - |
| NLX84_RS14755 (NLX84_14755) | 3092302..3093294 | - | 993 | WP_135638311.1 | D-cysteine desulfhydrase | - |
| NLX84_RS14760 (NLX84_14760) | 3093419..3093928 | - | 510 | WP_004934751.1 | flagella biosynthesis regulatory protein FliZ | - |
| NLX84_RS14765 (NLX84_14765) | 3093983..3094705 | - | 723 | WP_004934752.1 | RNA polymerase sigma factor FliA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | fliZ / fliA | 3083120..3094705 | 11585 | |
| - | inside | Prophage | - | fliZ / fliA | 3089310..3094705 | 5395 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 7523.89 Da Isoelectric Point: 11.1475
>T251398 WP_015378230.1 NZ_CP100765:3089310-3089513 [Serratia nematodiphila]
VKSSELIALLESHGWVLRRVKGSHHQFKHPDFALIITVPHPKKDLKLGTLRQILKDAGLSALHIATR
VKSSELIALLESHGWVLRRVKGSHHQFKHPDFALIITVPHPKKDLKLGTLRQILKDAGLSALHIATR
Download Length: 204 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 14888.63 Da Isoelectric Point: 5.4867
>AT251398 WP_015378231.1 NZ_CP100765:3089525-3089938 [Serratia nematodiphila]
MFYPAYIHTESNGSASGFFPDVPGCYFAGTSLDDAFADAQSALDAHFELLSEDNQPLPRPHAVAAHLAKDAGSFEGGQWL
LVAINMDKFDGRAERINITLPHRLLSRIDSLVRQHPGYGSRSGFLAAAARNELLKAE
MFYPAYIHTESNGSASGFFPDVPGCYFAGTSLDDAFADAQSALDAHFELLSEDNQPLPRPHAVAAHLAKDAGSFEGGQWL
LVAINMDKFDGRAERINITLPHRLLSRIDSLVRQHPGYGSRSGFLAAAARNELLKAE
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P0QK57 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086GDG8 |