Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3089310..3089938 Replicon chromosome
Accession NZ_CP100765
Organism Serratia nematodiphila strain SASK3000

Toxin (Protein)


Gene name hicA Uniprot ID A0A0P0QK57
Locus tag NLX84_RS14730 Protein ID WP_015378230.1
Coordinates 3089310..3089513 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A086GDG8
Locus tag NLX84_RS14735 Protein ID WP_015378231.1
Coordinates 3089525..3089938 (+) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX84_RS14725 (NLX84_14725) 3085175..3089146 + 3972 WP_033632771.1 trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase -
NLX84_RS14730 (NLX84_14730) 3089310..3089513 + 204 WP_015378230.1 type II toxin-antitoxin system HicA family toxin Toxin
NLX84_RS14735 (NLX84_14735) 3089525..3089938 + 414 WP_015378231.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NLX84_RS14740 (NLX84_14740) 3089968..3090720 - 753 WP_033632770.1 L-cystine ABC transporter ATP-binding protein TcyN -
NLX84_RS14745 (NLX84_14745) 3090724..3091386 - 663 WP_015378233.1 cystine ABC transporter permease -
NLX84_RS14750 (NLX84_14750) 3091386..3092186 - 801 WP_135638309.1 cystine ABC transporter substrate-binding protein -
NLX84_RS14755 (NLX84_14755) 3092302..3093294 - 993 WP_135638311.1 D-cysteine desulfhydrase -
NLX84_RS14760 (NLX84_14760) 3093419..3093928 - 510 WP_004934751.1 flagella biosynthesis regulatory protein FliZ -
NLX84_RS14765 (NLX84_14765) 3093983..3094705 - 723 WP_004934752.1 RNA polymerase sigma factor FliA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - fliZ / fliA 3083120..3094705 11585
- inside Prophage - fliZ / fliA 3089310..3094705 5395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-129)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 7523.89 Da        Isoelectric Point: 11.1475

>T251398 WP_015378230.1 NZ_CP100765:3089310-3089513 [Serratia nematodiphila]
VKSSELIALLESHGWVLRRVKGSHHQFKHPDFALIITVPHPKKDLKLGTLRQILKDAGLSALHIATR

Download         Length: 204 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 14888.63 Da        Isoelectric Point: 5.4867

>AT251398 WP_015378231.1 NZ_CP100765:3089525-3089938 [Serratia nematodiphila]
MFYPAYIHTESNGSASGFFPDVPGCYFAGTSLDDAFADAQSALDAHFELLSEDNQPLPRPHAVAAHLAKDAGSFEGGQWL
LVAINMDKFDGRAERINITLPHRLLSRIDSLVRQHPGYGSRSGFLAAAARNELLKAE

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P0QK57

Antitoxin

Source ID Structure
AlphaFold DB A0A086GDG8

References