Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1751472..1751997 Replicon chromosome
Accession NZ_CP100765
Organism Serratia nematodiphila strain SASK3000

Toxin (Protein)


Gene name relE Uniprot ID A0A8B4GJ35
Locus tag NLX84_RS08280 Protein ID WP_033633469.1
Coordinates 1751472..1751756 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A8B4GIN1
Locus tag NLX84_RS08285 Protein ID WP_004928423.1
Coordinates 1751746..1751997 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX84_RS08255 (NLX84_08255) 1746734..1747867 + 1134 WP_004938650.1 putrescine ABC transporter ATP-binding subunit PotG -
NLX84_RS08260 (NLX84_08260) 1747892..1748854 + 963 WP_033633472.1 putrescine ABC transporter permease PotH -
NLX84_RS08265 (NLX84_08265) 1748851..1749696 + 846 WP_004938644.1 putrescine ABC transporter permease PotI -
NLX84_RS08270 (NLX84_08270) 1749801..1750286 + 486 WP_050501266.1 YbjO family protein -
NLX84_RS08275 (NLX84_08275) 1750348..1751475 + 1128 WP_033633470.1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC -
NLX84_RS08280 (NLX84_08280) 1751472..1751756 - 285 WP_033633469.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NLX84_RS08285 (NLX84_08285) 1751746..1751997 - 252 WP_004928423.1 prevent-host-death protein Antitoxin
NLX84_RS08290 (NLX84_08290) 1752099..1752833 - 735 WP_033633468.1 arginine ABC transporter substrate-binding protein -
NLX84_RS08295 (NLX84_08295) 1753033..1753701 - 669 WP_004928418.1 arginine ABC transporter permease ArtM -
NLX84_RS08300 (NLX84_08300) 1753701..1754417 - 717 WP_004928413.1 arginine ABC transporter permease ArtQ -
NLX84_RS08305 (NLX84_08305) 1754427..1755158 - 732 WP_004928409.1 arginine ABC transporter substrate-binding protein -
NLX84_RS08310 (NLX84_08310) 1755191..1755919 - 729 WP_004928406.1 arginine ABC transporter ATP-binding protein ArtP -
NLX84_RS08315 (NLX84_08315) 1756182..1756724 - 543 WP_015377301.1 lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10789.91 Da        Isoelectric Point: 10.6941

>T251393 WP_033633469.1 NZ_CP100765:c1751756-1751472 [Serratia nematodiphila]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHVPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9108.39 Da        Isoelectric Point: 4.5203

>AT251393 WP_004928423.1 NZ_CP100765:c1751997-1751746 [Serratia nematodiphila]
MTVQPILADSAVSISDFKKSPNAALKEAQGQPVAVLTNGKISGYYVSPETWEAIAEYLEDIELAEIVRSRMNGKRIKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4GJ35

Antitoxin

Source ID Structure
AlphaFold DB A0A8B4GIN1

References