Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1622881..1623434 | Replicon | chromosome |
Accession | NZ_CP100765 | ||
Organism | Serratia nematodiphila strain SASK3000 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A086G3V8 |
Locus tag | NLX84_RS07710 | Protein ID | WP_033633716.1 |
Coordinates | 1623126..1623434 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | NLX84_RS07705 | Protein ID | WP_135637970.1 |
Coordinates | 1622881..1623123 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX84_RS07690 (NLX84_07690) | 1619373..1620908 | + | 1536 | WP_004938996.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
NLX84_RS07695 (NLX84_07695) | 1620961..1621881 | + | 921 | WP_049241281.1 | glutathione ABC transporter permease GsiC | - |
NLX84_RS07700 (NLX84_07700) | 1621891..1622799 | + | 909 | WP_174262909.1 | glutathione ABC transporter permease GsiD | - |
NLX84_RS07705 (NLX84_07705) | 1622881..1623123 | + | 243 | WP_135637970.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NLX84_RS07710 (NLX84_07710) | 1623126..1623434 | + | 309 | WP_033633716.1 | CcdB family protein | Toxin |
NLX84_RS07715 (NLX84_07715) | 1623471..1624313 | - | 843 | WP_048322602.1 | S-formylglutathione hydrolase | - |
NLX84_RS07720 (NLX84_07720) | 1624328..1625452 | - | 1125 | WP_164122942.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
NLX84_RS07725 (NLX84_07725) | 1625482..1626402 | - | 921 | WP_004938975.1 | LysR family transcriptional regulator | - |
NLX84_RS07730 (NLX84_07730) | 1626508..1627665 | + | 1158 | WP_004938972.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11448.21 Da Isoelectric Point: 5.0196
>T251392 WP_033633716.1 NZ_CP100765:1623126-1623434 [Serratia nematodiphila]
MQFTVYDNTYPASAYPYLLDVQSDLIDALSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQLGKA
VGNANEHRNQIKAAIDFLIDGF
MQFTVYDNTYPASAYPYLLDVQSDLIDALSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQLGKA
VGNANEHRNQIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|