Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1120406..1121027 Replicon chromosome
Accession NZ_CP100765
Organism Serratia nematodiphila strain SASK3000

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag NLX84_RS05230 Protein ID WP_004940313.1
Coordinates 1120406..1120609 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag NLX84_RS05235 Protein ID WP_004940312.1
Coordinates 1120659..1121027 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX84_RS05210 (NLX84_05210) 1115924..1117294 + 1371 WP_033633990.1 amidase -
NLX84_RS05215 (NLX84_05215) 1117345..1119285 - 1941 WP_033633989.1 NAD(P)/FAD-dependent oxidoreductase -
NLX84_RS05220 (NLX84_05220) 1119615..1119890 + 276 WP_050501286.1 hypothetical protein -
NLX84_RS05225 (NLX84_05225) 1119942..1120139 + 198 WP_050501285.1 cytochrome b/b6 domain-containing protein -
NLX84_RS05230 (NLX84_05230) 1120406..1120609 - 204 WP_004940313.1 HHA domain-containing protein Toxin
NLX84_RS05235 (NLX84_05235) 1120659..1121027 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
NLX84_RS05240 (NLX84_05240) 1121186..1121539 - 354 WP_004940311.1 hypothetical protein -
NLX84_RS05245 (NLX84_05245) 1121945..1122658 + 714 WP_033634146.1 ABC transporter ATP-binding protein -
NLX84_RS05250 (NLX84_05250) 1122655..1123512 + 858 WP_033633988.1 metal ABC transporter permease -
NLX84_RS05255 (NLX84_05255) 1123537..1124415 + 879 WP_021504668.1 metal ABC transporter substrate-binding protein -
NLX84_RS05260 (NLX84_05260) 1124524..1124664 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
NLX84_RS05265 (NLX84_05265) 1124677..1124931 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T251391 WP_004940313.1 NZ_CP100765:c1120609-1120406 [Serratia nematodiphila]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT251391 WP_004940312.1 NZ_CP100765:c1121027-1120659 [Serratia nematodiphila]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References