Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 14160..14761 | Replicon | chromosome |
Accession | NZ_CP100765 | ||
Organism | Serratia nematodiphila strain SASK3000 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0P0Q8I8 |
Locus tag | NLX84_RS00065 | Protein ID | WP_004933929.1 |
Coordinates | 14160..14540 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A086G6A0 |
Locus tag | NLX84_RS00070 | Protein ID | WP_004933932.1 |
Coordinates | 14540..14761 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX84_RS00040 (NLX84_00040) | 9406..10686 | + | 1281 | WP_049278441.1 | DUF3748 domain-containing protein | - |
NLX84_RS00045 (NLX84_00045) | 10717..11064 | - | 348 | WP_082997390.1 | YceK/YidQ family lipoprotein | - |
NLX84_RS00050 (NLX84_00050) | 11374..11787 | + | 414 | WP_004933919.1 | small heat shock chaperone IbpA | - |
NLX84_RS00055 (NLX84_00055) | 11895..12323 | + | 429 | WP_004933922.1 | small heat shock chaperone IbpB | - |
NLX84_RS00060 (NLX84_00060) | 12491..14149 | + | 1659 | WP_033631397.1 | putative transporter | - |
NLX84_RS00065 (NLX84_00065) | 14160..14540 | - | 381 | WP_004933929.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLX84_RS00070 (NLX84_00070) | 14540..14761 | - | 222 | WP_004933932.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NLX84_RS00075 (NLX84_00075) | 14836..16086 | - | 1251 | WP_004933935.1 | valine--pyruvate transaminase | - |
NLX84_RS00080 (NLX84_00080) | 16222..18285 | - | 2064 | WP_033631398.1 | alpha-amylase | - |
NLX84_RS00085 (NLX84_00085) | 18481..18633 | + | 153 | WP_015376155.1 | hypothetical protein | - |
NLX84_RS00090 (NLX84_00090) | 18635..19612 | - | 978 | WP_033631399.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14173.48 Da Isoelectric Point: 7.3170
>T251388 WP_004933929.1 NZ_CP100765:c14540-14160 [Serratia nematodiphila]
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHTNPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHTNPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P0Q8I8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086G6A0 |