Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4390789..4391458 | Replicon | chromosome |
| Accession | NZ_CP100764 | ||
| Organism | Serratia plymuthica strain SASK2000 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7U3Z5B1 |
| Locus tag | NLX81_RS20890 | Protein ID | WP_013814381.1 |
| Coordinates | 4390789..4391211 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S4YS10 |
| Locus tag | NLX81_RS20895 | Protein ID | WP_004952428.1 |
| Coordinates | 4391192..4391458 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX81_RS20870 (NLX81_20870) | 4386674..4387192 | + | 519 | WP_004952413.1 | flavodoxin FldB | - |
| NLX81_RS20875 (NLX81_20875) | 4387230..4388594 | - | 1365 | WP_013814378.1 | cell envelope integrity protein CreD | - |
| NLX81_RS20880 (NLX81_20880) | 4388679..4390097 | - | 1419 | WP_013814379.1 | two-component system sensor histidine kinase CreC | - |
| NLX81_RS20885 (NLX81_20885) | 4390094..4390789 | - | 696 | WP_013814380.1 | two-component system response regulator CreB | - |
| NLX81_RS20890 (NLX81_20890) | 4390789..4391211 | - | 423 | WP_013814381.1 | protein YgfX | Toxin |
| NLX81_RS20895 (NLX81_20895) | 4391192..4391458 | - | 267 | WP_004952428.1 | FAD assembly factor SdhE | Antitoxin |
| NLX81_RS20900 (NLX81_20900) | 4391783..4392775 | + | 993 | WP_013814382.1 | tRNA-modifying protein YgfZ | - |
| NLX81_RS20905 (NLX81_20905) | 4392923..4393600 | - | 678 | WP_004952439.1 | hemolysin III family protein | - |
| NLX81_RS20910 (NLX81_20910) | 4393791..4394399 | + | 609 | WP_013814383.1 | HD domain-containing protein | - |
| NLX81_RS20915 (NLX81_20915) | 4394446..4395771 | - | 1326 | WP_013814384.1 | MFS transporter | - |
| NLX81_RS20920 (NLX81_20920) | 4395768..4396421 | - | 654 | WP_013814385.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16448.47 Da Isoelectric Point: 10.6049
>T251387 WP_013814381.1 NZ_CP100764:c4391211-4390789 [Serratia plymuthica]
VAQWRCNVRISWRTQLLSLLTHGVLILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLANKRLSWHGQ
EWLLVKQPWMPRYGILLTLQPIQGKKCRRLWLASDSMGKAEWRHLRQLLLHPSADDDEEP
VAQWRCNVRISWRTQLLSLLTHGVLILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLANKRLSWHGQ
EWLLVKQPWMPRYGILLTLQPIQGKKCRRLWLASDSMGKAEWRHLRQLLLHPSADDDEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U3Z5B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S4YS10 |