Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 3982941..3983408 Replicon chromosome
Accession NZ_CP100764
Organism Serratia plymuthica strain SASK2000

Toxin (Protein)


Gene name relE Uniprot ID A0A7U3Z4I7
Locus tag NLX81_RS18990 Protein ID WP_013814082.1
Coordinates 3982941..3983210 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7U3Z4H1
Locus tag NLX81_RS18995 Protein ID WP_013814083.1
Coordinates 3983214..3983408 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX81_RS18960 (NLX81_18960) 3978005..3978520 + 516 WP_013814078.1 hypothetical protein -
NLX81_RS18965 (NLX81_18965) 3978559..3978807 + 249 WP_006316897.1 GlsB/YeaQ/YmgE family stress response membrane protein -
NLX81_RS18970 (NLX81_18970) 3978857..3980137 - 1281 WP_013814079.1 uracil permease -
NLX81_RS18975 (NLX81_18975) 3980330..3980956 - 627 WP_006316899.1 uracil phosphoribosyltransferase -
NLX81_RS18980 (NLX81_18980) 3981212..3982249 + 1038 WP_013814080.1 phosphoribosylformylglycinamidine cyclo-ligase -
NLX81_RS18985 (NLX81_18985) 3982249..3982887 + 639 WP_013814081.1 phosphoribosylglycinamide formyltransferase -
NLX81_RS18990 (NLX81_18990) 3982941..3983210 - 270 WP_013814082.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NLX81_RS18995 (NLX81_18995) 3983214..3983408 - 195 WP_013814083.1 hypothetical protein Antitoxin
NLX81_RS19000 (NLX81_19000) 3983555..3984106 + 552 WP_004951898.1 spermidine N1-acetyltransferase -
NLX81_RS19005 (NLX81_19005) 3984153..3984296 - 144 Protein_3717 IS4 family transposase -
NLX81_RS19010 (NLX81_19010) 3984505..3984870 - 366 WP_013814084.1 DUF596 domain-containing protein -
NLX81_RS19015 (NLX81_19015) 3985250..3985987 - 738 WP_239440950.1 hemagglutinin -
NLX81_RS19020 (NLX81_19020) 3986004..3986258 + 255 Protein_3720 spermidine acetyltransferase -
NLX81_RS19025 (NLX81_19025) 3986375..3986710 - 336 WP_254754635.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10641.22 Da        Isoelectric Point: 6.0726

>T251386 WP_013814082.1 NZ_CP100764:c3983210-3982941 [Serratia plymuthica]
MRIEWSREAQEELWNIIDYIDDRNPQAALILQREIETAVHSLSLNPFMYRLGRVDNTREIVVHPNYLIVYRIIGHIEVLS
VIHAKREYP

Download         Length: 270 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7443.65 Da        Isoelectric Point: 10.2045

>AT251386 WP_013814083.1 NZ_CP100764:c3983408-3983214 [Serratia plymuthica]
MVIKTSLSTQPTAEVAEQGESYDRWFRAKIEAAINSEKPRIPHEQVMNEMQIRLAAKKKIRKME

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U3Z4I7

Antitoxin

Source ID Structure
AlphaFold DB A0A7U3Z4H1

References