Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3216284..3216909 | Replicon | chromosome |
| Accession | NZ_CP100764 | ||
| Organism | Serratia plymuthica strain SASK2000 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U3Z353 |
| Locus tag | NLX81_RS15345 | Protein ID | WP_013813456.1 |
| Coordinates | 3216284..3216466 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A7U4DXE6 |
| Locus tag | NLX81_RS15350 | Protein ID | WP_013813457.1 |
| Coordinates | 3216496..3216909 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX81_RS15340 (NLX81_15340) | 3212146..3216117 | + | 3972 | Protein_2996 | trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase | - |
| NLX81_RS15345 (NLX81_15345) | 3216284..3216466 | + | 183 | WP_013813456.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NLX81_RS15350 (NLX81_15350) | 3216496..3216909 | + | 414 | WP_013813457.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NLX81_RS15355 (NLX81_15355) | 3216942..3217694 | - | 753 | WP_013813458.1 | L-cystine ABC transporter ATP-binding protein TcyN | - |
| NLX81_RS15360 (NLX81_15360) | 3217698..3218360 | - | 663 | WP_013813459.1 | cystine ABC transporter permease | - |
| NLX81_RS15365 (NLX81_15365) | 3218360..3219160 | - | 801 | WP_013813460.1 | cystine ABC transporter substrate-binding protein | - |
| NLX81_RS15370 (NLX81_15370) | 3219275..3220267 | - | 993 | WP_013813461.1 | D-cysteine desulfhydrase | - |
| NLX81_RS15375 (NLX81_15375) | 3220393..3220902 | - | 510 | WP_013813462.1 | flagella biosynthesis regulatory protein FliZ | - |
| NLX81_RS15380 (NLX81_15380) | 3220959..3221681 | - | 723 | WP_013813463.1 | RNA polymerase sigma factor FliA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6992.28 Da Isoelectric Point: 11.3081
>T251385 WP_013813456.1 NZ_CP100764:3216284-3216466 [Serratia plymuthica]
VKSSELIRLLEREGWVLERIKGSHHQFKHPRSRLVITVPHPRKDLKPGTLRQIMKDAGLC
VKSSELIRLLEREGWVLERIKGSHHQFKHPRSRLVITVPHPRKDLKPGTLRQIMKDAGLC
Download Length: 183 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15038.71 Da Isoelectric Point: 4.6961
>AT251385 WP_013813457.1 NZ_CP100764:3216496-3216909 [Serratia plymuthica]
MFYPAYVHSDLDGSASGFFPDVPGCYFAGDTLDKAFEDAKGALDAHFELLSEDNQAIPRPQAVSFHLAQENDTLNGGQWL
LVDINMDKFDGRAERINITLPHRLLNRIDSLVQQHPGYGSRSAFLAAAARNELSKAG
MFYPAYVHSDLDGSASGFFPDVPGCYFAGDTLDKAFEDAKGALDAHFELLSEDNQAIPRPQAVSFHLAQENDTLNGGQWL
LVDINMDKFDGRAERINITLPHRLLNRIDSLVQQHPGYGSRSAFLAAAARNELSKAG
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U3Z353 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4DXE6 |