Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1151965..1152587 | Replicon | chromosome |
| Accession | NZ_CP100764 | ||
| Organism | Serratia plymuthica strain SASK2000 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | S4YCZ4 |
| Locus tag | NLX81_RS05420 | Protein ID | WP_006322256.1 |
| Coordinates | 1151965..1152168 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S4YKH5 |
| Locus tag | NLX81_RS05425 | Protein ID | WP_004949348.1 |
| Coordinates | 1152219..1152587 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX81_RS05410 (NLX81_05410) | 1148331..1149005 | - | 675 | WP_013811773.1 | DNA N-6-adenine-methyltransferase | - |
| NLX81_RS05415 (NLX81_05415) | 1149245..1151254 | - | 2010 | WP_013811774.1 | glycosyl hydrolase family 28-related protein | - |
| NLX81_RS05420 (NLX81_05420) | 1151965..1152168 | - | 204 | WP_006322256.1 | HHA domain-containing protein | Toxin |
| NLX81_RS05425 (NLX81_05425) | 1152219..1152587 | - | 369 | WP_004949348.1 | Hha toxicity modulator TomB | Antitoxin |
| NLX81_RS05430 (NLX81_05430) | 1152747..1153074 | - | 328 | Protein_1043 | hypothetical protein | - |
| NLX81_RS05435 (NLX81_05435) | 1153554..1154268 | + | 715 | Protein_1044 | ABC transporter ATP-binding protein | - |
| NLX81_RS05440 (NLX81_05440) | 1154265..1155122 | + | 858 | WP_013811777.1 | metal ABC transporter permease | - |
| NLX81_RS05445 (NLX81_05445) | 1155148..1156026 | + | 879 | WP_013811778.1 | metal ABC transporter substrate-binding protein | - |
| NLX81_RS05450 (NLX81_05450) | 1156142..1156282 | - | 141 | WP_013811779.1 | type B 50S ribosomal protein L36 | - |
| NLX81_RS05455 (NLX81_05455) | 1156295..1156549 | - | 255 | WP_004949355.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1135692..1152891 | 17199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8085.45 Da Isoelectric Point: 6.9764
>T251379 WP_006322256.1 NZ_CP100764:c1152168-1151965 [Serratia plymuthica]
MTKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPVAVWKFVR
MTKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPVAVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14203.92 Da Isoelectric Point: 4.5140
>AT251379 WP_004949348.1 NZ_CP100764:c1152587-1152219 [Serratia plymuthica]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEGICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEGICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B1KM53 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S4YKH5 |