Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 940378..941068 | Replicon | chromosome |
| Accession | NZ_CP100764 | ||
| Organism | Serratia plymuthica strain SASK2000 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | A0A7U3YZ62 |
| Locus tag | NLX81_RS04395 | Protein ID | WP_013811601.1 |
| Coordinates | 940694..941068 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | A0A7U3YZ40 |
| Locus tag | NLX81_RS04390 | Protein ID | WP_013811600.1 |
| Coordinates | 940378..940707 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX81_RS04370 (NLX81_04370) | 936275..937735 | - | 1461 | WP_004948989.1 | NCS1 family nucleobase:cation symporter-1 | - |
| NLX81_RS04375 (NLX81_04375) | 937902..938651 | + | 750 | WP_013811597.1 | GntR family transcriptional regulator | - |
| NLX81_RS04380 (NLX81_04380) | 938648..939391 | + | 744 | WP_013811598.1 | allantoin racemase | - |
| NLX81_RS04385 (NLX81_04385) | 939411..940349 | + | 939 | WP_254754874.1 | allantoinase PuuE | - |
| NLX81_RS04390 (NLX81_04390) | 940378..940707 | - | 330 | WP_013811600.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NLX81_RS04395 (NLX81_04395) | 940694..941068 | - | 375 | WP_013811601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLX81_RS04400 (NLX81_04400) | 941174..943369 | - | 2196 | WP_254754875.1 | TonB-dependent siderophore receptor | - |
| NLX81_RS04405 (NLX81_04405) | 943405..944733 | - | 1329 | WP_013811603.1 | lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14031.35 Da Isoelectric Point: 9.8478
>T251378 WP_013811601.1 NZ_CP100764:c941068-940694 [Serratia plymuthica]
MDKHQVKQLIWIASSKKDLLSLPEEIIKSMGYTLHWVQAGLTPPGVNPLKGFLGAGVLEKVEDFDGNTYRAVYTVRFEDT
VFVLHCFQKKSKTGISTPKADIEFIKSRLSKAKQIYEDMKNGKI
MDKHQVKQLIWIASSKKDLLSLPEEIIKSMGYTLHWVQAGLTPPGVNPLKGFLGAGVLEKVEDFDGNTYRAVYTVRFEDT
VFVLHCFQKKSKTGISTPKADIEFIKSRLSKAKQIYEDMKNGKI
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U3YZ62 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U3YZ40 |