Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 3843840..3844381 | Replicon | chromosome |
| Accession | NZ_CP100755 | ||
| Organism | Alcaligenes sp. NLF5-7 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | MID00_RS17745 | Protein ID | WP_115633685.1 |
| Coordinates | 3844106..3844381 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | MID00_RS17740 | Protein ID | WP_115633686.1 |
| Coordinates | 3843840..3844106 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MID00_RS17715 (MID00_17715) | 3839210..3840118 | - | 909 | WP_254499217.1 | hypothetical protein | - |
| MID00_RS17720 (MID00_17720) | 3840126..3840725 | - | 600 | WP_254499218.1 | hypothetical protein | - |
| MID00_RS17725 (MID00_17725) | 3840749..3841498 | - | 750 | WP_254499219.1 | DsbC family protein | - |
| MID00_RS17730 (MID00_17730) | 3841520..3842008 | - | 489 | WP_254499220.1 | PH domain-containing protein | - |
| MID00_RS17735 (MID00_17735) | 3842101..3842907 | - | 807 | WP_254499221.1 | SprT-like domain-containing protein | - |
| MID00_RS17740 (MID00_17740) | 3843840..3844106 | + | 267 | WP_115633686.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| MID00_RS17745 (MID00_17745) | 3844106..3844381 | + | 276 | WP_115633685.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MID00_RS17750 (MID00_17750) | 3844485..3844703 | + | 219 | WP_254499222.1 | DUF3018 family protein | - |
| MID00_RS17755 (MID00_17755) | 3845246..3848479 | + | 3234 | WP_254499223.1 | helicase-related protein | - |
| MID00_RS17760 (MID00_17760) | 3848476..3849282 | + | 807 | WP_254499224.1 | DUF4391 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | sul1 / qacE / aadA2 / tet(C) | - | 3703376..3900507 | 197131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10851.71 Da Isoelectric Point: 10.3092
>T251372 WP_115633685.1 NZ_CP100755:3844106-3844381 [Alcaligenes sp. NLF5-7]
MKLKWTSKALSDLERLYEFLAVVNKPAAARAVQKLTKAPSILLSNPRIGEQLFMFEPREVRRILVGEYEIRYELQDSFIY
VLRIWHTRENR
MKLKWTSKALSDLERLYEFLAVVNKPAAARAVQKLTKAPSILLSNPRIGEQLFMFEPREVRRILVGEYEIRYELQDSFIY
VLRIWHTRENR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|