Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 30499..31009 Replicon chromosome
Accession NZ_CP100755
Organism Alcaligenes sp. NLF5-7

Toxin (Protein)


Gene name relB Uniprot ID U1YHF7
Locus tag MID00_RS00205 Protein ID WP_009459444.1
Coordinates 30746..31009 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID U1Y0D2
Locus tag MID00_RS00200 Protein ID WP_009459443.1
Coordinates 30499..30753 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MID00_RS00155 (MID00_00155) 25677..26156 - 480 WP_254499495.1 hypothetical protein -
MID00_RS00160 (MID00_00160) 26334..26582 - 249 WP_009459904.1 hypothetical protein -
MID00_RS00165 (MID00_00165) 26579..26959 - 381 WP_021446766.1 hypothetical protein -
MID00_RS00170 (MID00_00170) 26973..27296 - 324 WP_254499496.1 hypothetical protein -
MID00_RS00175 (MID00_00175) 27304..28011 - 708 WP_254499497.1 replication protein P -
MID00_RS00180 (MID00_00180) 27995..28780 - 786 WP_250757008.1 hypothetical protein -
MID00_RS00185 (MID00_00185) 29043..29234 - 192 WP_094196318.1 hypothetical protein -
MID00_RS00190 (MID00_00190) 29317..30006 + 690 WP_088453217.1 S24 family peptidase -
MID00_RS00195 (MID00_00195) 30043..30309 - 267 WP_035275328.1 hypothetical protein -
MID00_RS00200 (MID00_00200) 30499..30753 + 255 WP_009459443.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
MID00_RS00205 (MID00_00205) 30746..31009 + 264 WP_009459444.1 Txe/YoeB family addiction module toxin Toxin
MID00_RS00215 (MID00_00215) 32542..32778 - 237 WP_254499498.1 hypothetical protein -
MID00_RS00220 (MID00_00220) 32916..33674 + 759 WP_009459460.1 M48 family metallopeptidase -
MID00_RS00225 (MID00_00225) 34010..34411 + 402 WP_009459461.1 YchJ family metal-binding protein -
MID00_RS00230 (MID00_00230) 34408..34878 + 471 WP_009459462.1 GNAT family N-acetyltransferase -
MID00_RS00235 (MID00_00235) 34916..35434 + 519 WP_009459463.1 DedA family protein -
MID00_RS00240 (MID00_00240) 35441..35785 + 345 WP_009459464.1 SMR family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10382.88 Da        Isoelectric Point: 9.0343

>T251369 WP_009459444.1 NZ_CP100755:30746-31009 [Alcaligenes sp. NLF5-7]
MTDRLLCWTDAAWIDYVYWQGQDRKTLKRINRLIEEVRRAPFDGIGKPEALKENLSGFWSRRIDDTNRLVYAVDKASITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9416.59 Da        Isoelectric Point: 4.7778

>AT251369 WP_009459443.1 NZ_CP100755:30499-30753 [Alcaligenes sp. NLF5-7]
MKIISFSEARNSLKAVLDSVVDDASTTIITRRDAEDAVVMSLDYYNSLMETVHLLRSPANAEHLSRSIEQYRAGKAMPRE
LSDD

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U1YHF7

Antitoxin

Source ID Structure
AlphaFold DB U1Y0D2

References